Comparing SMc02118 FitnessBrowser__Smeli:SMc02118 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4z9nB Abc transporter / periplasmic binding protein from brucella ovis with glutathione bound
71% identity, 94% coverage: 20:341/341 of query aligns to 1:324/324 of 4z9nB
2v25A Structure of the campylobacter jejuni antigen peb1a, an aspartate and glutamate receptor with bound aspartate (see paper)
32% identity, 51% coverage: 27:201/341 of query aligns to 3:176/231 of 2v25A
5t0wA Crystal structure of the ancestral amino acid-binding protein anccdt- 1, a precursor of cyclohexadienyl dehydratase
28% identity, 68% coverage: 25:255/341 of query aligns to 1:218/229 of 5t0wA
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
29% identity, 70% coverage: 33:271/341 of query aligns to 3:218/226 of 4zv1A
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
29% identity, 70% coverage: 33:271/341 of query aligns to 3:216/225 of 4zv2A
1xt8B Crystal structure of cysteine-binding protein from campylobacter jejuni at 2.0 a resolution (see paper)
27% identity, 67% coverage: 26:254/341 of query aligns to 6:226/251 of 1xt8B
6svfA Crystal structure of the p235gk mutant of argbp from t. Maritima (see paper)
27% identity, 67% coverage: 27:256/341 of query aligns to 3:221/229 of 6svfA
6h20A Glnh bound to asn, mycobacterium tuberculosis (see paper)
30% identity, 61% coverage: 12:220/341 of query aligns to 29:230/287 of 6h20A
6h1uA Glnh bound to asp, mycobacterium tuberculosis (see paper)
30% identity, 61% coverage: 12:220/341 of query aligns to 29:230/287 of 6h1uA
6h2tA Glnh bound to glu, mycobacterium tuberculosis (see paper)
30% identity, 61% coverage: 12:220/341 of query aligns to 30:231/288 of 6h2tA
2ia4B Crystal structure of novel amino acid binding protein from shigella flexneri
25% identity, 63% coverage: 22:237/341 of query aligns to 4:221/278 of 2ia4B
2vhaA Debp (see paper)
25% identity, 63% coverage: 22:237/341 of query aligns to 3:220/276 of 2vhaA
8ovoA X-ray structure of the sf-iglusnfr-s72a in complex with l-aspartate
25% identity, 63% coverage: 22:237/341 of query aligns to 1:218/503 of 8ovoA
3k4uE Crystal structure of putative binding component of abc transporter from wolinella succinogenes dsm 1740 complexed with lysine
27% identity, 65% coverage: 33:255/341 of query aligns to 3:216/234 of 3k4uE
5eyfB Crystal structure of solute-binding protein from enterococcus faecium with bound glutamate
27% identity, 54% coverage: 58:242/341 of query aligns to 38:214/243 of 5eyfB
2yjpA Crystal structure of the solute receptors for l-cysteine of neisseria gonorrhoeae (see paper)
25% identity, 70% coverage: 24:263/341 of query aligns to 1:229/247 of 2yjpA
4ymxA Crystal structure of the substrate binding protein of an amino acid abc transporter (see paper)
28% identity, 58% coverage: 58:254/341 of query aligns to 28:214/224 of 4ymxA
Sites not aligning to the query:
7a99B Crystal structure of the phe57trp mutant of the arginine-bound form of domain 1 from tmargbp (see paper)
28% identity, 32% coverage: 27:134/341 of query aligns to 2:111/130 of 7a99B
3vvfA Crystal structure of ttc0807 complexed with arginine (see paper)
23% identity, 66% coverage: 26:250/341 of query aligns to 9:222/241 of 3vvfA
3vveA Crystal structure of ttc0807 complexed with lysine (see paper)
23% identity, 66% coverage: 26:250/341 of query aligns to 9:222/241 of 3vveA
>SMc02118 FitnessBrowser__Smeli:SMc02118
MARRILTALVGAAVVGIGTHAASAATLDDVKAKGFVQCGVNTGLAGFAAPDASGNWSGFD
VDYCKAIAAAIFGDGSKVKYTPLSAKERFPALQSGEVDVLARNTTWSINRDTALGFNFRP
VNYYDGQGFMVRKELDVKSALELSGAAVCVQTGTTTELNLADYFKANNLQYNPVVFEKLE
EVNAAYDAGRCDVYTTDQSGLYSLRLTLSKPDDHIVLPEIISKEPLAPAVRQGDDQWFDI
VSWVHYALVQAEEFGVTQANLEEMKKSTNPDVQRFLGVEADSKIGTDLGLTNEWAVNIVK
AVGNYGEVFDRNIGAGSPLKIERGLNALWNKGGLQYAPPVR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory