Comparing SMc02171 FitnessBrowser__Smeli:SMc02171 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4ry9B Crystal structure of carbohydrate transporter solute binding protein veis_2079 from verminephrobacter eiseniae ef01-2, target efi-511009, a complex with d-talitol
29% identity, 76% coverage: 35:294/341 of query aligns to 10:265/297 of 4ry9B
4ry9A Crystal structure of carbohydrate transporter solute binding protein veis_2079 from verminephrobacter eiseniae ef01-2, target efi-511009, a complex with d-talitol
29% identity, 76% coverage: 35:294/341 of query aligns to 10:265/297 of 4ry9A
2ioyA Crystal structure of thermoanaerobacter tengcongensis ribose binding protein (see paper)
29% identity, 86% coverage: 32:325/341 of query aligns to 5:274/274 of 2ioyA
2fn8A Thermotoga maritima ribose binding protein ribose bound form (see paper)
27% identity, 89% coverage: 32:336/341 of query aligns to 6:289/292 of 2fn8A
5ibqA Crystal structure of an abc solute binding protein from rhizobium etli cfn 42 (rhe_pf00037,target efi-511357) in complex with alpha-d-apiose
29% identity, 83% coverage: 31:313/341 of query aligns to 6:269/287 of 5ibqA
4ry0A Crystal structure of ribose transporter solute binding protein rhe_pf00037 from rhizobium etli cfn 42, target efi-511357, in complex with d-ribose
29% identity, 83% coverage: 31:313/341 of query aligns to 6:269/287 of 4ry0A
4zjpA Structure of an abc-transporter solute binding protein (sbp_ipr025997) from actinobacillus succinogenes (asuc_0197, target efi-511067) with bound beta-d-ribopyranose
31% identity, 80% coverage: 31:302/341 of query aligns to 6:256/270 of 4zjpA
1dbpA Identical mutations at corresponding positions in two homologous proteins with non-identical effects (see paper)
29% identity, 80% coverage: 31:302/341 of query aligns to 5:256/271 of 1dbpA
2h3hA Crystal structure of the liganded form of thermotoga maritima glucose binding protein (see paper)
32% identity, 83% coverage: 38:320/341 of query aligns to 11:285/313 of 2h3hA
Sites not aligning to the query:
3c6qC Apo and ligand-bound form of a thermophilic glucose/xylose binding protein
32% identity, 83% coverage: 38:320/341 of query aligns to 11:285/305 of 3c6qC
Sites not aligning to the query:
5dteB Crystal structure of an abc transporter periplasmic solute binding protein (ipr025997) from actinobacillus succinogenes 130z(asuc_0081, target efi-511065) with bound d-allose
28% identity, 80% coverage: 31:304/341 of query aligns to 6:270/287 of 5dteB
8wlbA X-ray structure of enterobacter cloacae allose-binding protein in complex with d-psicose (see paper)
29% identity, 83% coverage: 25:307/341 of query aligns to 1:273/288 of 8wlbA
8wl9A X-ray structure of enterobacter cloacae allose-binding protein in complex with d-ribose (see paper)
29% identity, 83% coverage: 25:307/341 of query aligns to 1:273/288 of 8wl9A
3ksmA Crystal structure of abc-type sugar transport system, periplasmic component from hahella chejuensis
28% identity, 85% coverage: 31:321/341 of query aligns to 4:276/276 of 3ksmA
1rpjA Crystal structure of d-allose binding protein from escherichia coli (see paper)
28% identity, 78% coverage: 25:291/341 of query aligns to 1:258/288 of 1rpjA
1gudA Hinge-bending motion of d-allose binding protein from escherichia coli: three open conformations (see paper)
28% identity, 78% coverage: 25:291/341 of query aligns to 1:258/288 of 1gudA
6hbdA Crystal structure of msmeg_1712 from mycobacterium smegmatis in complex with beta-d-galactofuranose (see paper)
29% identity, 70% coverage: 47:284/341 of query aligns to 22:250/305 of 6hbdA
Sites not aligning to the query:
6hyhA Crystal structure of msmeg_1712 from mycobacterium smegmatis in complex with beta-d-fucofuranose (see paper)
29% identity, 70% coverage: 47:284/341 of query aligns to 21:249/304 of 6hyhA
Sites not aligning to the query:
6hbmA Crystal structure of msmeg_1712 from mycobacterium smegmatis in complex with alpha-l-arabinofuranose (see paper)
29% identity, 70% coverage: 47:284/341 of query aligns to 21:249/304 of 6hbmA
Sites not aligning to the query:
7e7mC Crystal structure analysis of the streptococcus agalactiae ribose binding protein rbsb
28% identity, 75% coverage: 36:292/341 of query aligns to 17:253/284 of 7e7mC
>SMc02171 FitnessBrowser__Smeli:SMc02171
MKKTVLSAAFGALAMGVAFASPSQAAEVSACLITKTDTNPFFVKMKEGAAAKAKELGVTL
KSYAGKIDGDSESQVAAIETCIADGAKGILIAASDTQGIVPQVQKARDAGLLVIALDTPL
EPLDAADATFATDNLLAGKLIGQWAAATLGDAAKEAKVAFLDLTPSQPSVDVLRDQGFMI
GFGIDPKDPNKIGDEDDPRIVGHDITNGNEEGGRTAMENLLQKDPTINVVHTINEPAAAG
AYEALKSVGREKDVLIVSVDGGCPGVKNVAEGVIGATSQQYPLMMAALGIEAIKKFADTG
EKPTPTEGKDFVDTGVSLVTDKPVSGVESIDTKTGMEKCWG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory