Comparing SMc02227 SMc02227 fatty oxidation complex enoyl-COA hydratase/3-hydroxyacyl-COA dehydrogenase/3-hydroxybutyryl-COA epimerase to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8oqlA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-1
43% identity, 96% coverage: 1:709/737 of query aligns to 9:722/728 of 8oqlA
4b3iA Crystal structure of mycobacterium tuberculosis fatty acid beta-oxidation complex with coenzymea bound at the hydratase active sites (see paper)
43% identity, 96% coverage: 1:709/737 of query aligns to 12:725/731 of 4b3iA
8oqsB Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-83
43% identity, 96% coverage: 1:709/737 of query aligns to 16:729/735 of 8oqsB
Sites not aligning to the query:
8oqvA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-109
43% identity, 96% coverage: 1:709/737 of query aligns to 8:721/726 of 8oqvA
Sites not aligning to the query:
8oqrA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-80
43% identity, 96% coverage: 1:709/737 of query aligns to 10:723/728 of 8oqrA
8oqoA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-49
43% identity, 96% coverage: 1:709/737 of query aligns to 9:722/727 of 8oqoA
8pf8A Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-72
43% identity, 96% coverage: 1:709/737 of query aligns to 10:723/729 of 8pf8A
Sites not aligning to the query:
8oquA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-92
43% identity, 96% coverage: 1:709/737 of query aligns to 11:724/730 of 8oquA
8oqtA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-91
43% identity, 96% coverage: 1:709/737 of query aligns to 10:723/729 of 8oqtA
Sites not aligning to the query:
8oqnA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-53
43% identity, 96% coverage: 1:709/737 of query aligns to 10:723/729 of 8oqnA
8opvA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with resveratrol (fragment-b-h11)
43% identity, 96% coverage: 1:709/737 of query aligns to 10:723/729 of 8opvA
8opuA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with sulfamethoxazole (fragment-b-e1)
43% identity, 96% coverage: 1:709/737 of query aligns to 10:723/729 of 8opuA
8oqqA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-79
43% identity, 96% coverage: 4:709/737 of query aligns to 7:717/723 of 8oqqA
8oqpA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-76
43% identity, 96% coverage: 4:709/737 of query aligns to 7:717/723 of 8oqpA
7o4uA Structure of the alpha subunit of mycobacterium tuberculosis beta- oxidation trifunctional enzyme in complex with oxidized nicotinamide adenine dinucleotide (see paper)
43% identity, 96% coverage: 4:709/737 of query aligns to 2:705/711 of 7o4uA
6yswA E. Coli anaerobic trifunctional enzyme subunit-alpha in complex with coenzyme a
35% identity, 98% coverage: 6:724/737 of query aligns to 4:703/707 of 6yswA
P40939 Trifunctional enzyme subunit alpha, mitochondrial; 78 kDa gastrin-binding protein; Monolysocardiolipin acyltransferase; TP-alpha; EC 2.3.1.-; EC 4.2.1.17; EC 1.1.1.211 from Homo sapiens (Human) (see 5 papers)
33% identity, 98% coverage: 2:724/737 of query aligns to 39:762/763 of P40939
1wdmA Fatty acid beta-oxidation multienzyme complex from pseudomonas fragi, form i (native3) (see paper)
35% identity, 97% coverage: 14:725/737 of query aligns to 16:707/707 of 1wdmA
1wdlA Fatty acid beta-oxidation multienzyme complex from pseudomonas fragi, form ii (native4) (see paper)
35% identity, 97% coverage: 14:725/737 of query aligns to 16:715/715 of 1wdlA
P28793 Fatty acid oxidation complex subunit alpha; EC 4.2.1.17; EC 5.1.2.3; EC 5.3.3.8; EC 1.1.1.35 from Pseudomonas fragi (see paper)
35% identity, 97% coverage: 14:725/737 of query aligns to 16:715/715 of P28793
>SMc02227 SMc02227 fatty oxidation complex enoyl-COA hydratase/3-hydroxyacyl-COA dehydrogenase/3-hydroxybutyryl-COA epimerase
MSYTNFKIETDADGIALVTWDMPDKSMNVFTEEVMKELDAIIDQTTADPAVKGVVITSGK
SSFSGGADLSMIKSMFTFQAEERKKDPDNAARKLFDLVGRMTGLFRKLETSGKPWVSAIN
GTCMGGAFEMSLACHGRVASNAKSVKIALPEVKVGIFPGAGGTQRVPRLTNTQDALQMMT
TGSSLTPARAKAMGLVHEVVDPDKLIEAAKAMIKNGLKPVQPWDEKGFKLPGGGIWTPAS
AQLWPAASGILRRETYGNYPGAIAILKCVYEGLQVPFDTALKIEQRYFTEILQTTEAFSM
IRSLFVSMQELGKGARRPAGVPKTELKKVGVVGAGFMGASIAYVTAAGGIPVTLIDRDME
AAEKGKTHSEGLVKDAIGKGRLTKEEGEALLSRITPSADYGDLRDAGLVIEAVFEDRQVK
KDVIEKVEAVIAEDAIFASNTSTLPITGLARNSKRPDRFIGIHFFSPVEKMMLTEVILGK
ETGDRALAAALDYVAAIRKTPIVVNDTRGFYVNRCVFRYIHEAYDMLIEGVPPAMIENAA
KMAGMPVGPLSLNDEVAIDLSQKILKAAVADLGDKAVDLRHMALIDKMVDELDRRGRKNG
KGFYEYPAKPARKYLWPGLKELYPQKDAGEIEVGVLKQRLLVTIALEAARTIEEGIVTDP
READVGSILGFGFAPYTGGTLSYIDGMGAKAFVELCEKLAADHGDHFRPTPLLKEMAEKG
ETFYGRFDPYGAGQKAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory