Comparing SMc02228 SMc02228 acetyl-CoA acetyltransferase to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7o4tD Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme with coenzyme a bound at the hydratase, thiolase active sites and possible additional binding site (coa(ech/had)) (see paper)
58% identity, 100% coverage: 3:402/402 of query aligns to 4:403/403 of 7o4tD
O53871 Putative acyltransferase Rv0859; EC 2.3.1.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
58% identity, 100% coverage: 3:402/402 of query aligns to 4:403/403 of O53871
8pf8C Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-72
58% identity, 100% coverage: 3:402/402 of query aligns to 3:402/402 of 8pf8C
8oqsC Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-83
58% identity, 100% coverage: 3:402/402 of query aligns to 3:402/402 of 8oqsC
8oqpC Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-76
58% identity, 100% coverage: 3:402/402 of query aligns to 3:402/402 of 8oqpC
4b3iC Crystal structure of mycobacterium tuberculosis fatty acid beta-oxidation complex with coenzymea bound at the hydratase active sites (see paper)
58% identity, 100% coverage: 3:402/402 of query aligns to 3:402/402 of 4b3iC
8oqoC Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-49
58% identity, 100% coverage: 3:402/402 of query aligns to 3:398/398 of 8oqoC
8opyD Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-b-dnq
58% identity, 100% coverage: 3:402/402 of query aligns to 4:401/401 of 8opyD
8oqmD Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-10
58% identity, 100% coverage: 3:402/402 of query aligns to 4:399/399 of 8oqmD
8oqlC Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-1
58% identity, 100% coverage: 3:402/402 of query aligns to 3:397/397 of 8oqlC
8opuC Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with sulfamethoxazole (fragment-b-e1)
58% identity, 100% coverage: 3:402/402 of query aligns to 3:399/399 of 8opuC
8opxC Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with trehalose (fragment-b-tre)
58% identity, 100% coverage: 3:402/402 of query aligns to 3:398/398 of 8opxC
4ubvA Structure of the 3-ketoacyl-coa thiolase fada5 from m. Tuberculosis with an partially acetylated cysteine in complex with acetyl-coa and coa (see paper)
38% identity, 99% coverage: 5:402/402 of query aligns to 5:391/391 of 4ubvA
I6XHI4 Steroid 3-ketoacyl-CoA thiolase; Acetyl-CoA acetyltransferase FadA5; Beta-ketoacyl-CoA thiolase; EC 2.3.1.16 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
38% identity, 99% coverage: 5:402/402 of query aligns to 5:391/391 of I6XHI4
4ubtA Structure of the c93s variant of the 3-ketoacyl-coa thiolase fada5 from m. Tuberculosis in complex with a steroid and coa. (see paper)
38% identity, 99% coverage: 5:402/402 of query aligns to 10:396/396 of 4ubtA
2d3tC Fatty acid beta-oxidation multienzyme complex from pseudomonas fragi, form v (see paper)
37% identity, 99% coverage: 4:402/402 of query aligns to 7:390/390 of 2d3tC
P45359 Acetyl-CoA acetyltransferase; Acetoacetyl-CoA thiolase; CaTHL; EC 2.3.1.9 from Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) (see paper)
36% identity, 100% coverage: 1:401/402 of query aligns to 1:391/392 of P45359
1ou6A Biosynthetic thiolase from zoogloea ramigera in complex with acetyl-o- pantetheine-11-pivalate
38% identity, 96% coverage: 17:402/402 of query aligns to 16:392/392 of 1ou6A
2vu2A Biosynthetic thiolase from z. Ramigera. Complex with s-pantetheine-11- pivalate. (see paper)
38% identity, 96% coverage: 17:402/402 of query aligns to 13:389/389 of 2vu2A
1dm3A Acetylated biosynthetic thiolase from zoogloea ramigera in complex with acetyl-coa (see paper)
38% identity, 96% coverage: 17:402/402 of query aligns to 13:389/389 of 1dm3A
>SMc02228 SMc02228 acetyl-CoA acetyltransferase
MTKVFVYDHVRTPRGRGKKDGALHEVPSVRLAAKVLEAVRDRNGLDTSTVDDVIMGCVDP
VMDAGAVIPKAAAFEAGYSTRAPGMQISRFCASGLDAVNFGAAKIAQGADDIVIAGGVES
MSRVGLGMSGGAWFMDPSVNLPAYFMPQGVSADLIATKYGFSRDDVDAYAVESQKRAANA
WEKGYFKNSVVPVKDQNGLVILDRDEHMRPGTDMQALASLNPSFQMPGEMGGFEAVGIQA
HPEIERINYVHHAGNSSGIVDGAAAVLIGSKAGGEAMGLKPRARIRAFANIGSDPALMLT
GPVDVTEKLLKRADMKLSDIDLFELNEAFAAVVLRYCQAFDIPHDKINVNGGAIAMGHPL
GATGAMILGTVLDELERRDLNTALVTLCIGAGMGTATIIERV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory