SitesBLAST
Comparing SMc02252 FitnessBrowser__Smeli:SMc02252 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7k3pA The structure of the udp-glc/glcnac 4-epimerase from the human pathogen campylobacter jejuni
48% identity, 94% coverage: 3:323/342 of query aligns to 4:328/329 of 7k3pA
- binding nicotinamide-adenine-dinucleotide: G8 (= G7), G11 (= G10), Y12 (= Y11), I13 (= I12), D32 (= D31), N33 (≠ C32), S35 (= S34), G37 (= G36), D57 (= D51), L58 (≠ V52), F79 (= F73), A80 (= A74), I83 (≠ A77), N98 (= N92), Y147 (= Y142), K151 (= K146), Y175 (= Y169), N177 (= N171), V178 (= V172)
2c20A Crystal structure of udp-glucose 4-epimerase
44% identity, 97% coverage: 2:332/342 of query aligns to 2:329/329 of 2c20A
- active site: T117 (= T117), A118 (= A118), A119 (= A119), Y141 (= Y142), K145 (= K146), H184 (≠ T185)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), Y11 (= Y11), I12 (= I12), D31 (= D31), N32 (≠ C32), Q34 (≠ S34), T35 (= T35), G36 (= G36), D51 (= D51), L52 (≠ V52), F73 (= F73), A74 (= A74), A75 (≠ G75), N92 (= N92), Y141 (= Y142), K145 (= K146), Y168 (= Y169), F169 (= F170), V171 (= V172), H184 (≠ T185)
- binding zinc ion: E182 (≠ Q183), H184 (≠ T185), E187 (≠ A188), H189 (= H190)
2udpA Udp-galactose 4-epimerase complexed with udp-phenol (see paper)
41% identity, 94% coverage: 1:322/342 of query aligns to 1:330/338 of 2udpA
- active site: S124 (≠ T117), A125 (= A118), T126 (≠ A119), Y149 (= Y142), K153 (= K146), M189 (≠ A181)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), Y11 (= Y11), I12 (= I12), D31 (= D31), N32 (≠ C32), L33 (= L33), C34 (≠ S34), N35 (≠ T35), S36 (≠ G36), D58 (= D51), I59 (≠ V52), F80 (= F73), A81 (= A74), G82 (= G75), K84 (≠ A77), S122 (= S115), S124 (≠ T117), Y149 (= Y142), K153 (= K146), Y177 (= Y169)
- binding phenyl-uridine-5'-diphosphate: N179 (= N171), N199 (≠ H190), L200 (= L191), A216 (≠ D207), I217 (≠ V208), F218 (≠ L209), R231 (= R222), Y233 (= Y224), V269 (= V260), R292 (= R283), D295 (= D286)
1udcA Structure of udp-galactose-4-epimerase complexed with udp-mannose (see paper)
41% identity, 94% coverage: 1:322/342 of query aligns to 1:330/338 of 1udcA
- active site: S124 (≠ T117), A125 (= A118), T126 (≠ A119), Y149 (= Y142), K153 (= K146), M189 (≠ A181)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), Y11 (= Y11), I12 (= I12), D31 (= D31), N32 (≠ C32), C34 (≠ S34), N35 (≠ T35), S36 (≠ G36), D58 (= D51), I59 (≠ V52), F80 (= F73), A81 (= A74), G82 (= G75), K84 (≠ A77), S122 (= S115), Y149 (= Y142), K153 (= K146), Y177 (= Y169), P180 (≠ V172)
- binding uridine-5'-diphosphate-mannose: T126 (≠ A119), Y149 (= Y142), N179 (= N171), N199 (≠ H190), L200 (= L191), L215 (≠ I206), A216 (≠ D207), I217 (≠ V208), F218 (≠ L209), R231 (= R222), Y233 (= Y224), V269 (= V260), R292 (= R283)
P09147 UDP-glucose 4-epimerase; Galactowaldenase; UDP-galactose 4-epimerase; EC 5.1.3.2 from Escherichia coli (strain K12) (see 10 papers)
41% identity, 94% coverage: 1:322/342 of query aligns to 1:330/338 of P09147
- YI 11:12 (= YI 11:12) binding
- DNLCNS 31:36 (≠ DCLSTG 31:36) binding
- DI 58:59 (≠ DV 51:52) binding
- FAGLK 80:84 (≠ FAGSA 73:77) binding
- N99 (= N92) binding
- S124 (≠ T117) binding ; mutation to A: No major structural changes. Catalytic efficiency is very low and affinity binding is 21% of the wild-type enzyme.; mutation to T: No major structural changes. Catalytic efficiency is about 30% of that of the wild-type enzyme, and affinity binding is similar to that of the native enzyme.
- Y149 (= Y142) active site, Proton acceptor; binding ; mutation to F: No major structural changes. Catalytic efficiency is very low and affinity binding is 12% of the wild-type enzyme.
- K153 (= K146) binding ; mutation to A: Decreases the catalytic activity. Not reduced by sugars in the presence or absence of UMP. It contains very little NADH.; mutation to M: Decreases the catalytic activity. Not reduced by sugars in the presence or absence of UMP. It contains very little NADH.
- F178 (= F170) binding
- Y299 (≠ I290) mutation to C: Loss of epimerase activity with UDP-Gal by almost 5-fold, but it results in a gain of epimerase activity with uridine diphosphate N-acetylglucosamine (UDP-GlcNAc) by 230-fold with minimal changes in its three-dimensional structure.
1kvrA Udp-galactose 4-epimerase complexed with udp-phenol (see paper)
41% identity, 94% coverage: 1:322/342 of query aligns to 1:330/338 of 1kvrA
- active site: A124 (≠ T117), A125 (= A118), T126 (≠ A119), Y149 (= Y142), K153 (= K146), M189 (≠ A181)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), Y11 (= Y11), I12 (= I12), D31 (= D31), N32 (≠ C32), C34 (≠ S34), N35 (≠ T35), S36 (≠ G36), D58 (= D51), I59 (≠ V52), F80 (= F73), A81 (= A74), G82 (= G75), K84 (≠ A77), S122 (= S115), S123 (= S116), Y149 (= Y142), K153 (= K146), Y177 (= Y169), P180 (≠ V172)
- binding uridine-5'-diphosphate: N179 (= N171), N198 (≠ T189), N199 (≠ H190), L200 (= L191), A216 (≠ D207), I217 (≠ V208), F218 (≠ L209), R231 (= R222), Y233 (= Y224), V269 (= V260), R292 (= R283), D295 (= D286)
Q9SA77 UDP-arabinose 4-epimerase 1; UDP-D-xylose 4-epimerase 1; EC 5.1.3.5 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
41% identity, 94% coverage: 3:322/342 of query aligns to 73:403/419 of Q9SA77
- G275 (≠ V194) mutation to D: In mur4-1; 50% reduction in L-Ara in cell wall material.
- R304 (= R222) mutation to Q: In mur4-3; 50% reduction in L-Ara in cell wall material.
4twrA Structure of udp-glucose 4-epimerase from brucella abortus
43% identity, 92% coverage: 3:317/342 of query aligns to 4:316/325 of 4twrA
- active site: S117 (≠ T117), C118 (≠ A118), A119 (= A119), Y141 (= Y142), K145 (= K146), H184 (≠ T185), H189 (= H190)
- binding nicotinamide-adenine-dinucleotide: G8 (= G7), G11 (= G10), F12 (≠ Y11), I13 (= I12), D32 (= D31), N33 (≠ C32), L34 (= L33), S35 (= S34), T36 (= T35), G37 (= G36), D51 (= D51), I52 (≠ V52), F73 (= F73), A74 (= A74), A75 (≠ G75), N92 (= N92), S115 (= S115), K145 (= K146), Y168 (= Y169), A171 (≠ V172), H184 (≠ T185)
- binding zinc ion: E182 (≠ Q183), H184 (≠ T185), E187 (≠ A188), H189 (= H190)
1udaA Structure of udp-galactose-4-epimerase complexed with udp-4-deoxy-4- fluoro-alpha-d-galactose (see paper)
41% identity, 94% coverage: 1:322/342 of query aligns to 1:330/338 of 1udaA
- active site: S124 (≠ T117), A125 (= A118), T126 (≠ A119), Y149 (= Y142), K153 (= K146), M189 (≠ A181)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), Y11 (= Y11), I12 (= I12), D31 (= D31), N32 (≠ C32), L33 (= L33), C34 (≠ S34), N35 (≠ T35), S36 (≠ G36), D58 (= D51), I59 (≠ V52), F80 (= F73), A81 (= A74), G82 (= G75), K84 (≠ A77), S122 (= S115), Y149 (= Y142), K153 (= K146), Y177 (= Y169), P180 (≠ V172)
- binding uridine-5'-diphosphate-4-deoxy-4-fluoro-alpha-d-galactose: T126 (≠ A119), N179 (= N171), N199 (≠ H190), L200 (= L191), A216 (≠ D207), I217 (≠ V208), F218 (≠ L209), R231 (= R222), Y233 (= Y224), R292 (= R283), D295 (= D286), Y299 (≠ I290)
1naiA Udp-galactose 4-epimerase from escherichia coli, oxidized (see paper)
41% identity, 94% coverage: 1:322/342 of query aligns to 1:330/338 of 1naiA
- active site: S124 (≠ T117), A125 (= A118), T126 (≠ A119), Y149 (= Y142), K153 (= K146), M189 (≠ A181)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), Y11 (= Y11), I12 (= I12), D31 (= D31), N32 (≠ C32), L33 (= L33), C34 (≠ S34), N35 (≠ T35), S36 (≠ G36), D58 (= D51), I59 (≠ V52), F80 (= F73), A81 (= A74), G82 (= G75), K84 (≠ A77), Y149 (= Y142), K153 (= K146), Y177 (= Y169), P180 (≠ V172)
- binding 1,3-propandiol: N35 (≠ T35), K84 (≠ A77), E191 (≠ Q183), P193 (≠ T185)
- binding uridine-5'-diphosphate: N179 (= N171), N199 (≠ H190), L200 (= L191), L215 (≠ I206), A216 (≠ D207), R231 (= R222), Y233 (= Y224), R292 (= R283)
1lrjA Crystal structure of e. Coli udp-galactose 4-epimerase complexed with udp-n-acetylglucosamine (see paper)
41% identity, 94% coverage: 1:322/342 of query aligns to 1:330/338 of 1lrjA
- active site: S124 (≠ T117), A125 (= A118), T126 (≠ A119), Y149 (= Y142), K153 (= K146), M189 (≠ A181)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), Y11 (= Y11), I12 (= I12), D31 (= D31), N32 (≠ C32), L33 (= L33), C34 (≠ S34), N35 (≠ T35), S36 (≠ G36), D58 (= D51), I59 (≠ V52), F80 (= F73), A81 (= A74), G82 (= G75), K84 (≠ A77), Y149 (= Y142), K153 (= K146), Y177 (= Y169), P180 (≠ V172)
- binding uridine-diphosphate-n-acetylglucosamine: V86 (= V79), S124 (≠ T117), F178 (= F170), N179 (= N171), L200 (= L191), L215 (≠ I206), A216 (≠ D207), F218 (≠ L209), R231 (= R222), Y233 (= Y224), V269 (= V260), R292 (= R283), D295 (= D286)
1a9yA Udp-galactose 4-epimerase mutant s124a/y149f complexed with udp- glucose (see paper)
41% identity, 94% coverage: 1:322/342 of query aligns to 1:330/338 of 1a9yA
- active site: A124 (≠ T117), A125 (= A118), T126 (≠ A119), F149 (≠ Y142), K153 (= K146)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), Y11 (= Y11), I12 (= I12), D31 (= D31), N32 (≠ C32), C34 (≠ S34), N35 (≠ T35), S36 (≠ G36), D58 (= D51), I59 (≠ V52), F80 (= F73), A81 (= A74), G82 (= G75), K84 (≠ A77), S122 (= S115), S123 (= S116), F149 (≠ Y142), K153 (= K146), Y177 (= Y169), P180 (≠ V172)
- binding uridine-5'-diphosphate-glucose: A125 (= A118), T126 (≠ A119), N179 (= N171), N199 (≠ H190), L200 (= L191), A216 (≠ D207), I217 (≠ V208), F218 (≠ L209), R231 (= R222), Y233 (= Y224), R292 (= R283), D295 (= D286), Y299 (≠ I290)
7kn1A Crystal structure of udp-glucose-4-epimerase (gale) from stenotrophomonas maltophila with bound NAD and formylated udp- arabinopyranose
40% identity, 95% coverage: 1:326/342 of query aligns to 3:335/336 of 7kn1A
- active site: S126 (≠ T117), Y150 (= Y142), K154 (= K146)
- binding nicotinamide-adenine-dinucleotide: G9 (= G7), G12 (= G10), Y13 (= Y11), I14 (= I12), D33 (= D31), S34 (≠ C32), C36 (≠ S34), N37 (≠ T35), D60 (= D51), I61 (≠ V52), F82 (= F73), A83 (= A74), A84 (≠ G75), K86 (≠ A77), S124 (= S115), S125 (= S116), S126 (≠ T117), Y150 (= Y142), K154 (= K146), Y178 (= Y169), P181 (≠ V172)
- binding UDP-4-deoxy-4-formamido-beta-L-arabinopyranose: V88 (= V79), S126 (≠ T117), Y150 (= Y142), N180 (= N171), S199 (≠ T189), N200 (≠ H190), L201 (= L191), Q217 (≠ D207), V218 (= V208), F219 (≠ L209), R232 (= R222), Y234 (= Y224), V270 (= V260), R293 (= R283), D296 (= D286)
6k0iA Crystal structure of udp-glucose 4-epimerase from bifidobacterium longum in complex with NAD+ and udp-glc (see paper)
40% identity, 94% coverage: 3:322/342 of query aligns to 3:329/335 of 6k0iA
- active site: S124 (≠ T117), A125 (= A118), T126 (≠ A119), Y149 (= Y142), K153 (= K146)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), F11 (≠ Y11), I12 (= I12), D31 (= D31), N32 (≠ S34), N35 (≠ F37), S36 (≠ R38), D58 (= D51), V59 (= V52), F80 (= F73), A81 (= A74), G82 (= G75), K84 (≠ A77), N99 (= N92), S122 (= S115), S123 (= S116), Y149 (= Y142), K153 (= K146), Y177 (= Y169), P180 (≠ V172)
- binding uridine-5'-diphosphate-glucose: K84 (≠ A77), S124 (≠ T117), Y149 (= Y142), F178 (= F170), N179 (= N171), A198 (≠ T189), N199 (≠ H190), L200 (= L191), Q216 (≠ D207), V217 (= V208), Y218 (≠ L209), R231 (= R222), Y233 (= Y224), V268 (= V260), R291 (= R283), D294 (= D286)
6k0hA Crystal structure of udp-glucose 4-epimerase from bifidobacterium longum in complex with NAD+ and udp-glcnac (see paper)
40% identity, 94% coverage: 3:322/342 of query aligns to 3:329/335 of 6k0hA
- active site: S124 (≠ T117), A125 (= A118), T126 (≠ A119), Y149 (= Y142), K153 (= K146)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), F11 (≠ Y11), I12 (= I12), D31 (= D31), N32 (≠ S34), G34 (= G36), N35 (≠ F37), S36 (≠ R38), D58 (= D51), V59 (= V52), F80 (= F73), A81 (= A74), G82 (= G75), K84 (≠ A77), N99 (= N92), S123 (= S116), Y149 (= Y142), K153 (= K146), Y177 (= Y169), P180 (≠ V172)
- binding uridine-diphosphate-n-acetylglucosamine: K84 (≠ A77), S124 (≠ T117), Y149 (= Y142), F178 (= F170), N179 (= N171), A198 (≠ T189), N199 (≠ H190), L200 (= L191), Q216 (≠ D207), V217 (= V208), Y218 (≠ L209), R231 (= R222), Y233 (= Y224), V268 (= V260), R291 (= R283), D294 (= D286)
6k0gA Crystal structure of udp-glucose 4-epimerase from bifidobacterium longum in complex with NAD+ and udp (see paper)
40% identity, 94% coverage: 3:322/342 of query aligns to 3:329/335 of 6k0gA
- active site: S124 (≠ T117), A125 (= A118), T126 (≠ A119), Y149 (= Y142), K153 (= K146)
- binding magnesium ion: E66 (≠ Q59), H114 (≠ A107)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), F11 (≠ Y11), I12 (= I12), D31 (= D31), N32 (≠ S34), N35 (≠ F37), S36 (≠ R38), D58 (= D51), V59 (= V52), F80 (= F73), A81 (= A74), G82 (= G75), K84 (≠ A77), N99 (= N92), S122 (= S115), S123 (= S116), Y149 (= Y142), K153 (= K146), Y177 (= Y169), P180 (≠ V172)
- binding uridine-5'-diphosphate: N179 (= N171), A198 (≠ T189), N199 (≠ H190), L200 (= L191), Q216 (≠ D207), V217 (= V208), Y218 (≠ L209), R231 (= R222), Y233 (= Y224), V268 (= V260), R291 (= R283), D294 (= D286)
2cnbA Trypanosoma brucei udp-galactose-4-epimerase in ternary complex with NAD and the substrate analogue udp-4-deoxy-4- fluoro-alpha-d-galactose (see paper)
37% identity, 96% coverage: 1:330/342 of query aligns to 3:365/366 of 2cnbA
- active site: S144 (≠ T117), A145 (= A118), A146 (= A119), Y169 (= Y142), K173 (= K146)
- binding nicotinamide-adenine-dinucleotide: G9 (= G7), G12 (= G10), Y13 (= Y11), I14 (= I12), D34 (= D31), S35 (≠ C32), V37 (vs. gap), G38 (vs. gap), D77 (= D51), V78 (= V52), M100 (≠ F73), C101 (≠ A74), A102 (≠ G75), L104 (≠ A77), N119 (= N92), S143 (= S116), S144 (≠ T117), Y169 (= Y142), K173 (= K146), Y196 (= Y169), F197 (= F170), A199 (≠ V172)
- binding uridine-5'-diphosphate-4-deoxy-4-fluoro-alpha-d-galactose: L104 (≠ A77), S144 (≠ T117), Y169 (= Y142), F197 (= F170), N198 (= N171), H217 (= H190), L218 (= L191), P238 (≠ D207), I239 (≠ V208), F240 (≠ L209), C251 (≠ G220), R253 (= R222), V297 (= V260), R320 (= R283), D323 (= D286)
3enkA 1.9a crystal structure of udp-glucose 4-epimerase from burkholderia pseudomallei
40% identity, 95% coverage: 3:326/342 of query aligns to 7:337/340 of 3enkA
- active site: S127 (= S116), S128 (≠ T117), T130 (≠ A119), Y152 (= Y142), K156 (= K146)
- binding nicotinamide-adenine-dinucleotide: G11 (= G7), G14 (= G10), Y15 (= Y11), I16 (= I12), D35 (= D31), N36 (≠ C32), V38 (≠ S34), N39 (≠ T35), S40 (≠ G36), D62 (= D51), V63 (= V52), F84 (= F73), A85 (= A74), A86 (≠ G75), K88 (≠ A77), N103 (= N92), S126 (= S115), S128 (≠ T117), Y152 (= Y142), K156 (= K146), Y180 (= Y169), P183 (≠ V172)
- binding uridine-5'-diphosphate-glucose: T130 (≠ A119), N182 (= N171), N201 (≠ T189), N202 (≠ H190), L203 (= L191), R219 (≠ D207), V220 (= V208), F221 (≠ L209), R234 (= R222), Y236 (= Y224), V272 (= V260), R295 (= R283), D298 (= D286)
Q564Q1 UDP-glucose 4-epimerase; Galactowaldenase; UDP-N-acetylgalactosamine 4-epimerase; UDP-GalNAc 4-epimerase; UDP-N-acetylglucosamine 4-epimerase; UDP-GlcNAc 4-epimerase; UDP-galactose 4-epimerase; EC 5.1.3.2; EC 5.1.3.7 from Caenorhabditis elegans (see paper)
36% identity, 94% coverage: 1:322/342 of query aligns to 1:341/349 of Q564Q1
- P314 (= P294) mutation to L: In pv18; at the restrictive temperature of 25 degrees Celsius, embryos have cell-cell adhesion defects and die before hatching. The few surviving animals are arrested at the L1 larval stage. At the permissive temperature of 16-20 degrees Celsius, causes a developmental delay. Distal tip cell migration is impaired due to a reduced localization of metalloprotease mig-17 to the gonad basement membrane. Vulva lumen is smaller at the L4 larval stage. Accumulation of UDP-galactose (Gal) and reduction in UDP-N-acetylgalactosamine (GalNAc) levels. Hypersensitivity to a galactose-rich diet characterized by a slow development often resulting in an arrest at the L1 larval stage. Up-regulation of ER stress response protein hsp-4; expression is suppressed in an xbp-1 RNAi-mediated knockdown animals. Reduced survival upon E.faecalis or S.aureus-mediated infection.
7xpqA Crystal structure of udp-glc/glcnac 4-epimerase with NAD/udp-glcnac (see paper)
39% identity, 94% coverage: 3:322/342 of query aligns to 4:336/343 of 7xpqA
- binding nicotinamide-adenine-dinucleotide: G8 (= G7), G11 (= G10), Y12 (= Y11), I13 (= I12), D32 (= D31), N33 (≠ C32), N36 (≠ T35), D62 (= D51), L63 (≠ V52), F84 (= F73), A85 (= A74), G86 (= G75), K88 (≠ A77), N103 (= N92), S126 (= S115), S128 (≠ T117), Y152 (= Y142), K156 (= K146), Y180 (= Y169), P183 (≠ V172)
- binding uridine-diphosphate-n-acetylglucosamine: N182 (= N171), N202 (≠ H190), L203 (= L191), T219 (≠ D207), Y221 (≠ L209), R234 (= R222), Y236 (= Y224), V275 (= V260), R298 (= R283), D301 (= D286)
Query Sequence
>SMc02252 FitnessBrowser__Smeli:SMc02252
MAVLVTGGAGYIGSHMVWSLLDGGEAVVVLDCLSTGFRWAVAPEARFYFGDVGDRALLQR
VFAENEIDSVVHFAGSAVVPESVANPLAYYENNTANTRTLIAATVEAGIRHFVFSSTAAV
YGTQDTPDPVSETAALRPQSPYGRSKLMSEMMLQDAAAAHDFRFVALRYFNVAGADPLGR
AGQSTLGATHLIKVACEAALGRRRKIDVLGTDYPTADGTGVRDYIHVSDLVAAHRSALAY
LRAGGEPLVANCGYGHGFSVLQVLDTVRQVSGRDFMVDYAPRRPGDPAQIVADPSVARLK
LDWVPTHASLEHIVRSAFDWESHLSRKNSFDEEQDERLIANG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory