Comparing SMc02256 FitnessBrowser__Smeli:SMc02256 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
O04373 IAA-amino acid hydrolase ILR1-like 4; jasmonoyl-L-amino acid hydrolase; EC 3.5.1.-; EC 3.5.1.127 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
39% identity, 95% coverage: 18:390/393 of query aligns to 48:423/440 of O04373
P54955 N-acetylcysteine deacetylase; S-(2-succino)cysteine metabolism operon protein P; EC 3.5.1.- from Bacillus subtilis (strain 168)
38% identity, 94% coverage: 18:386/393 of query aligns to 10:372/380 of P54955
4ewtA The crystal structure of a putative aminohydrolase from methicillin resistant staphylococcus aureus (see paper)
36% identity, 96% coverage: 4:379/393 of query aligns to 2:377/389 of 4ewtA
P54968 IAA-amino acid hydrolase ILR1; EC 3.5.1.- from Arabidopsis thaliana (Mouse-ear cress) (see paper)
37% identity, 94% coverage: 21:390/393 of query aligns to 55:427/442 of P54968
6slfA Nalpha-acylglutamine aminoacylase from corynebacterium sp.Releasing human axilla odorants co-crystallised with high affinity inhibitor (see paper)
39% identity, 86% coverage: 5:341/393 of query aligns to 6:344/398 of 6slfA
Sites not aligning to the query:
3ramA Crystal structure of hmra (see paper)
27% identity, 73% coverage: 11:296/393 of query aligns to 11:273/391 of 3ramA
Sites not aligning to the query:
5vo3A Crystal structure of dape in complex with the products (succinic acid and diaminopimelic acid) (see paper)
25% identity, 67% coverage: 13:275/393 of query aligns to 3:274/380 of 5vo3A
Sites not aligning to the query:
P44514 Succinyl-diaminopimelate desuccinylase; SDAP desuccinylase; N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase; EC 3.5.1.18 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 3 papers)
24% identity, 66% coverage: 17:275/393 of query aligns to 4:270/377 of P44514
Sites not aligning to the query:
>SMc02256 FitnessBrowser__Smeli:SMc02256
MVPDMKLSAAIDNAMPELVAIRRDLHAHPELGLEETRTSAFIARHLEELGYEVATGIAKT
GVVGTLRNGTGSRSIGIRADIDALPIQEETGVAYASTKPGLMHACGHDGHTAMLLGAARA
LAERRNFDGTIHLIFQPAEENAGGAKIMVDEGLFDRFPCDAVFALHNEPNLPFGQFALRE
GPIMAAVDEARITVHGRGGHGAEPQATADPIVCGASIVMALQTIVARNIHPMDPSVVTVG
AFHAGSASNIIPERAEIVVGIRSFDPAVRDELERRIRMIAEAQASSFGMRATVDYERSYD
ATINHKAETDFLREAAIRFAGADKVVDLARPFMGSEDFAYMLKERPGSYFFLGSRVTGEE
KSLHHPGYDFNDDLLPIGAAFWTELAEAYLARR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory