Comparing SMc02321 FitnessBrowser__Smeli:SMc02321 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 17 hits to proteins with known functional sites (download)
2hcvA Crystal structure of l-rhamnose isomerase from pseudomonas stutzeri with metal ion (see paper)
79% identity, 97% coverage: 5:421/430 of query aligns to 3:418/421 of 2hcvA
3iudA Cu2+-bound form of pseudomonas stutzeri l-rhamnose isomerase (see paper)
79% identity, 97% coverage: 5:421/430 of query aligns to 3:418/419 of 3iudA
2i57A Crystal structure of l-rhamnose isomerase from pseudomonas stutzeri in complex with d-allose (see paper)
79% identity, 97% coverage: 5:421/430 of query aligns to 3:418/419 of 2i57A
3itoA Crystal structure of pseudomonas stutzeri l-rhamnose isomerase mutant d327n in complex with d-psicose (see paper)
79% identity, 97% coverage: 5:421/430 of query aligns to 3:418/421 of 3itoA
3itlA Crystal structure of pseudomonas stutzeri l-rhamnose isomerase mutant d327n in complex with l-rhamnulose (see paper)
79% identity, 97% coverage: 5:421/430 of query aligns to 3:418/421 of 3itlA
3itvA Crystal structure of pseudomonas stutzeri l-rhamnose isomerase mutant s329k in complex with d-psicose (see paper)
79% identity, 97% coverage: 5:421/430 of query aligns to 3:418/421 of 3itvA
3iuhA Co2+-bound form of pseudomonas stutzeri l-rhamnose isomerase (see paper)
79% identity, 97% coverage: 5:420/430 of query aligns to 3:417/417 of 3iuhA
4gjjB Crystal structure of pseudomonas stutzeri l-rhamnose isomerase mutant h101n in complex with d-allopyranose (see paper)
79% identity, 97% coverage: 5:421/430 of query aligns to 3:418/421 of 4gjjB
4gjiB Crystal structure of pseudomonas stutzeri l-rhamnose isomerase mutant h101n in complex with l-rhamnopyranose (see paper)
79% identity, 97% coverage: 5:421/430 of query aligns to 3:418/421 of 4gjiB
Sites not aligning to the query:
3m0vC Crystal structure of pseudomonas stutzeri l-rhamnose isomerase mutant s329l in complex with l-rhamnose (see paper)
79% identity, 97% coverage: 5:421/430 of query aligns to 4:419/433 of 3m0vC
3ktcA Crystal structure of putative sugar isomerase (yp_050048.1) from erwinia carotovora atroseptica scri1043 at 1.54 a resolution
25% identity, 57% coverage: 139:385/430 of query aligns to 85:327/330 of 3ktcA
1ximA Arginine residues as stabilizing elements in proteins (see paper)
28% identity, 56% coverage: 141:379/430 of query aligns to 97:343/392 of 1ximA
Sites not aligning to the query:
2xinA Protein engineering of xylose (glucose) isomerase from actinoplanes missouriensis. 1. Crystallography and site-directed mutagenesis of metal binding sites (see paper)
28% identity, 56% coverage: 141:379/430 of query aligns to 97:343/392 of 2xinA
Sites not aligning to the query:
9ximA Protein engineering of xylose (glucose) isomerase from actinoplanes missouriensis. 1. Crystallography and site-directed mutagenesis of metal binding sites (see paper)
27% identity, 56% coverage: 141:379/430 of query aligns to 97:343/392 of 9ximA
Sites not aligning to the query:
1xinA Protein engineering of xylose (glucose) isomerase from actinoplanes missouriensis. 1. Crystallography and site-directed mutagenesis of metal binding sites (see paper)
27% identity, 56% coverage: 141:379/430 of query aligns to 97:343/392 of 1xinA
Sites not aligning to the query:
5xinA Protein engineering of xylose (glucose) isomerase from actinoplanes missouriensis. 1. Crystallography and site-directed mutagenesis of metal binding sites (see paper)
27% identity, 56% coverage: 141:379/430 of query aligns to 97:343/392 of 5xinA
Sites not aligning to the query:
3uvaC Crystal structure of l-rhamnose isomerase mutant w38f from bacillus halodurans in complex with mn (see paper)
25% identity, 59% coverage: 115:369/430 of query aligns to 110:355/405 of 3uvaC
>SMc02321 FitnessBrowser__Smeli:SMc02321
MTLMISTSVLDAENASRRDALTRDYESLGDRLARRGIDIDAVKAKVAAYGVAVPSWGVGT
GGTRFARFPGPGEPRNIFDKLEDCAVIQQLTRATPAVSLHIPWDKVSDLGALKEKGSALG
LSFDAMNSNTFSDAPGQAHSYKFGSLSHTDSATRRQAIEHNLECVEIGKALGSKALTVWV
GDGSNFPGQSNFTRAFERYLDSMKAVYAALPDDWRIFTEHKMFEPAFYSTVVQDWGTNYL
IAQELGPKAFCLVDLGHHAPNVNIEMIVARLIQFKKLGGFHFNDSKYGDDDLDTGSIDPY
RLFLVFNELVDAETRAANGFDPAHMLDQSHNVTDPIESLMTSAMEVGRAYAQALIVDRKA
LAGYQEENDALMASETLKTAFRTDVEPILATARLENDGAIAPVAAYRASGYRARVAAERP
AVAGGGGGIV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory