SitesBLAST
Comparing SMc02322 FitnessBrowser__Smeli:SMc02322 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
32% identity, 37% coverage: 434:692/699 of query aligns to 4:251/255 of 5itvA
- active site: G18 (= G448), S141 (= S576), Y154 (= Y589), K158 (= K593)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G444), S17 (≠ G447), G18 (= G448), I19 (= I449), D38 (= D468), I39 (= I469), T61 (≠ M495), I63 (≠ V497), N89 (= N523), G91 (= G525), T139 (≠ V574), S141 (= S576), Y154 (= Y589), K158 (= K593), P184 (= P619), G185 (≠ D620), I186 (≠ A621), I187 (≠ V622)
3m4rA Structure of the n-terminal class ii aldolase domain of a conserved protein from thermoplasma acidophilum
37% identity, 31% coverage: 10:225/699 of query aligns to 2:208/213 of 3m4rA
5itvD Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
33% identity, 37% coverage: 434:692/699 of query aligns to 4:223/227 of 5itvD
- active site: G18 (= G448), S141 (= S576), Y154 (= Y589), K158 (= K593)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G444), S17 (≠ G447), G18 (= G448), I19 (= I449), D38 (= D468), I39 (= I469), T61 (≠ M495), D62 (≠ N496), I63 (≠ V497), N89 (= N523), T139 (≠ V574), S141 (= S576), Y154 (= Y589), K158 (= K593), P184 (= P619), G185 (≠ D620), I187 (≠ V622)
3rwbA Crystal structure of complex of 4pal (4-pyridoxolactone) and pldh (tetrameric pyridoxal 4-dehydrogenase) from mesorhizobium loti
33% identity, 37% coverage: 435:692/699 of query aligns to 4:243/247 of 3rwbA
- active site: G17 (= G448), S140 (= S576), Y153 (= Y589), K157 (= K593)
- binding 7-hydroxy-6-methylfuro[3,4-c]pyridin-1(3H)-one: S140 (= S576), N141 (≠ K577), T142 (≠ N578), M150 (≠ A586), Y153 (= Y589), L185 (≠ A621), H196 (≠ Y641)
- binding nicotinamide-adenine-dinucleotide: G13 (= G444), Q16 (≠ G447), G17 (= G448), I18 (= I449), D37 (= D468), I38 (= I469), D60 (≠ N496), I61 (≠ V497), N87 (= N523), A88 (= A524), S89 (≠ G525), I138 (≠ V574), S140 (= S576), Y153 (= Y589), K157 (= K593), P183 (= P619), L185 (≠ A621), I186 (≠ V622), S188 (≠ W633), G190 (≠ E635), V191 (≠ Q636)
3ndrA Crystal structure of tetrameric pyridoxal 4-dehydrogenase from mesorhizobium loti
33% identity, 37% coverage: 435:692/699 of query aligns to 4:243/247 of 3ndrA
- active site: G17 (= G448), S140 (= S576), Y153 (= Y589), K157 (= K593)
- binding nicotinamide-adenine-dinucleotide: G13 (= G444), Q16 (≠ G447), G17 (= G448), I18 (= I449), D37 (= D468), I38 (= I469), D60 (≠ N496), I61 (≠ V497), N87 (= N523), A88 (= A524), S89 (≠ G525), V110 (≠ I546), I138 (≠ V574), S140 (= S576), Y153 (= Y589), K157 (= K593), P183 (= P619), L185 (≠ A621), I186 (≠ V622), S188 (≠ W633), G190 (≠ E635), V191 (≠ Q636)
3ak4A Crystal structure of nadh-dependent quinuclidinone reductase from agrobacterium tumefaciens
35% identity, 37% coverage: 435:692/699 of query aligns to 5:254/258 of 3ak4A
- active site: G18 (= G448), S141 (= S576), L151 (≠ A586), Y154 (= Y589), K158 (= K593), E199 (≠ T630)
- binding nicotinamide-adenine-dinucleotide: K17 (≠ G447), G18 (= G448), I19 (= I449), D38 (= D468), L39 (≠ I469), V60 (≠ M495), D61 (≠ N496), V62 (= V497), N88 (= N523), A89 (= A524), G90 (= G525), T139 (≠ V574), S141 (= S576), Y154 (= Y589), K158 (= K593), G185 (≠ D620), V187 (= V622), T189 (≠ R624), M191 (≠ S626)
8dt1C Crystal structure of a putative d-beta-hydroxybutyrate dehydrogenase from burkholderia cenocepacia j2315 in complex with NAD
36% identity, 37% coverage: 434:692/699 of query aligns to 1:255/259 of 8dt1C
- binding nicotinamide-adenine-dinucleotide: G11 (= G444), S14 (≠ G447), G15 (= G448), I16 (= I449), D35 (= D468), L36 (≠ I469), M60 (= M495), V62 (= V497), N88 (= N523), A89 (= A524), M139 (≠ V574), Y154 (= Y589), K158 (= K593), P184 (= P619), G185 (≠ D620), F186 (≠ A621), V187 (= V622), T189 (≠ S626)
6zzpA Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from psychrobacter arcticus complexed with NAD+ and 3-oxovalerate (see paper)
37% identity, 27% coverage: 433:619/699 of query aligns to 6:190/265 of 6zzpA
- binding nicotinamide-adenine-dinucleotide: G17 (= G444), S20 (≠ G447), G21 (= G448), I22 (= I449), D41 (= D468), I42 (= I469), M66 (= M495), D67 (≠ N496), V68 (= V497), N94 (= N523), A95 (= A524), G96 (= G525), M145 (≠ V574), S147 (= S576), Y160 (= Y589), K164 (= K593), P190 (= P619)
- binding 3-oxidanylidenepentanoic acid: Q98 (≠ A527), S147 (= S576), H149 (≠ N578), K157 (≠ A586), Y160 (= Y589)
Sites not aligning to the query:
6zzoC Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from psychrobacter arcticus complexed with NAD+ and acetoacetate (see paper)
37% identity, 27% coverage: 433:619/699 of query aligns to 6:190/265 of 6zzoC
- binding acetoacetic acid: Q98 (≠ A527), H149 (≠ N578), K157 (≠ A586)
- binding nicotinamide-adenine-dinucleotide: G17 (= G444), S20 (≠ G447), G21 (= G448), I22 (= I449), D41 (= D468), I42 (= I469), M66 (= M495), D67 (≠ N496), V68 (= V497), N94 (= N523), A95 (= A524), G96 (= G525), M145 (≠ V574), Y160 (= Y589), K164 (= K593), P190 (= P619)
Sites not aligning to the query:
7ejiB Crystal structure of kred f147l/l153q/y190p/l199a/m205f/m206f variant and methyl methacrylate complex
31% identity, 37% coverage: 435:692/699 of query aligns to 4:247/251 of 7ejiB
- binding methyl 2-methylprop-2-enoate: S142 (= S576), I143 (≠ K577), Y155 (= Y589), F205 (≠ Y652)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G444), T15 (≠ A446), L16 (≠ G447), G17 (= G448), I18 (= I449), R38 (vs. gap), H39 (vs. gap), D62 (≠ N496), A63 (≠ V497), N89 (= N523), A90 (= A524), V112 (≠ I546), M140 (≠ V574), S142 (= S576), Y155 (= Y589), K159 (= K593), P187 (= P619), P189 (≠ A621), I190 (≠ V622), T192 (≠ A639), P193 (≠ A640), L194 (≠ Y641)
7ejhA Crystal structure of kred mutant-f147l/l153q/y190p/l199a/m205f/m206f and 2-hydroxyisoindoline-1,3-dione complex
31% identity, 37% coverage: 435:692/699 of query aligns to 6:249/253 of 7ejhA
- binding 2-oxidanylisoindole-1,3-dione: S144 (= S576), I145 (≠ K577), E146 (≠ N578), Y157 (= Y589), V197 (≠ K642), F207 (≠ Y652)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G444), T17 (≠ A446), I20 (= I449), R40 (vs. gap), H41 (vs. gap), D64 (≠ N496), A65 (≠ V497), N91 (= N523), A92 (= A524), V114 (≠ I546), M142 (≠ V574), S144 (= S576), Y157 (= Y589), K161 (= K593), P189 (= P619), G190 (≠ D620), P191 (≠ A621), I192 (≠ V622), T194 (≠ A639), P195 (≠ A640), L196 (≠ Y641)
6d9yB Crystal structure of a short chain dehydrogenase/reductase sdr from burkholderia phymatum with partially occupied NAD
32% identity, 37% coverage: 435:694/699 of query aligns to 7:249/251 of 6d9yB
- active site: G20 (= G448), S145 (= S576), Y158 (= Y589)
- binding nicotinamide-adenine-dinucleotide: G16 (= G444), R19 (≠ G447), G20 (= G448), D40 (= D468), L41 (≠ I469), V64 (≠ M495), D65 (≠ N496), Q66 (≠ V497), A93 (= A524), S145 (= S576), Y158 (= Y589), K162 (= K593), P188 (= P619), A189 (= A638), A190 (= A639), A191 (= A640), T193 (≠ K642)
1g0oC Structure of trihydroxynaphthalene reductase in complex with NADPH and pyroquilon (see paper)
29% identity, 38% coverage: 430:692/699 of query aligns to 20:278/281 of 1g0oC
- active site: G38 (= G448), S162 (= S576), H173 (≠ A586), Y176 (= Y589), K180 (= K593), Y221 (≠ Q636)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G34 (= G444), R37 (≠ G447), G38 (= G448), I39 (= I449), A59 (≠ D470), N60 (≠ E471), S61 (≠ T472), N85 (= N496), V86 (= V497), N112 (= N523), S113 (≠ A524), G114 (= G525), M160 (≠ V574), Y176 (= Y589), K180 (= K593), P206 (= P619), G208 (≠ A621), I209 (≠ V622), T211 (≠ S626), M213 (≠ I628)
- binding pyroquilon: S162 (= S576), I163 (≠ K577), Y176 (= Y589), G208 (≠ A621), Y221 (≠ Q636)
1g0nA Structure of trihydroxynaphthalene reductase in complex with NADPH and 4,5,6,7-tetrachloro-phthalide (see paper)
29% identity, 38% coverage: 430:692/699 of query aligns to 12:270/273 of 1g0nA
- active site: G30 (= G448), S154 (= S576), H165 (≠ A586), Y168 (= Y589), K172 (= K593)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G26 (= G444), R29 (≠ G447), G30 (= G448), I31 (= I449), A51 (≠ D470), N52 (≠ E471), S53 (≠ T472), V78 (= V497), N104 (= N523), S105 (≠ A524), G106 (= G525), I127 (= I546), M152 (≠ V574), Y168 (= Y589), K172 (= K593), P198 (= P619), G200 (≠ A621), I201 (≠ V622), T203 (≠ S626), M205 (≠ I628)
- binding 4,5,6,7-tetrachloro-phthalide: S154 (= S576), Y168 (= Y589), G200 (≠ A621), M205 (≠ I628), Y206 (≠ W629), C210 (≠ W633), Y213 (≠ Q636), W233 (vs. gap)
1dohA Structure of trihydroxynaphthalene reductase in complex with NADPH and 4-nitro-inden-1-one (see paper)
29% identity, 38% coverage: 430:692/699 of query aligns to 12:270/273 of 1dohA
- active site: G30 (= G448), S154 (= S576), H165 (≠ A586), Y168 (= Y589), K172 (= K593), Y213 (≠ Q636)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G26 (= G444), R29 (≠ G447), G30 (= G448), I31 (= I449), A51 (≠ D470), N52 (≠ E471), S53 (≠ T472), N77 (= N496), V78 (= V497), N104 (= N523), S105 (≠ A524), G106 (= G525), M152 (≠ V574), Y168 (= Y589), K172 (= K593), P198 (= P619), G200 (≠ A621), I201 (≠ V622), T203 (≠ S626), M205 (≠ I628)
- binding 4-nitro-inden-1-one: Y168 (= Y589), G200 (≠ A621), Y206 (≠ W629), C210 (≠ W633), Y213 (≠ Q636)
1ybvA Structure of trihydroxynaphthalene reductase in complex with NADPH and an active site inhibitor (see paper)
29% identity, 38% coverage: 430:692/699 of query aligns to 9:267/270 of 1ybvA
- active site: G27 (= G448), S151 (= S576), H162 (≠ A586), Y165 (= Y589), K169 (= K593), Y210 (≠ Q636)
- binding 5-methyl-1,2,4-triazolo[3,4-b]benzothiazole: S151 (= S576), Y165 (= Y589), G197 (≠ A621), M202 (≠ I628), Y203 (≠ W629), Y210 (≠ Q636), W230 (vs. gap)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G23 (= G444), R26 (≠ G447), G27 (= G448), I28 (= I449), A48 (≠ D470), N49 (≠ E471), S50 (≠ T472), N74 (= N496), V75 (= V497), N101 (= N523), S102 (≠ A524), G103 (= G525), M149 (≠ V574), S151 (= S576), K169 (= K593), P195 (= P619), G197 (≠ A621), I198 (≠ V622), T200 (≠ S626), M202 (≠ I628)
6xewA Structure of serratia marcescens 2,3-butanediol dehydrogenase (see paper)
30% identity, 37% coverage: 438:696/699 of query aligns to 6:244/251 of 6xewA
- active site: G16 (= G448), S138 (= S576), Y151 (= Y589)
- binding r,3-hydroxybutan-2-one: S138 (= S576), S140 (≠ N578), Y151 (= Y589)
- binding s,3-hydroxybutan-2-one: S138 (= S576), Y151 (= Y589), S182 (≠ D620)
- binding nicotinamide-adenine-dinucleotide: G12 (= G444), N15 (≠ G447), G16 (= G448), M17 (≠ I449), D36 (= D468), W37 (≠ I469), W37 (≠ I469), A38 (≠ D470), I59 (≠ M495), D60 (≠ N496), V61 (= V497), N87 (= N523), A88 (= A524), G89 (= G525), V110 (≠ I546), T136 (≠ V574), S138 (= S576), Y151 (= Y589), K155 (= K593), S182 (≠ D620), L183 (≠ A621), V184 (= V622), T186 (≠ K627), N187 (≠ I628), M188 (≠ W629), T189 (= T630)
H9XP47 Meso-2,3-butanediol dehydrogenase; BDH; meso-2,3-BDH; (R,S)-butane-2,3-diol dehydrogenase; NAD(H)-dependent meso-2,3-BDH; SmBdh; EC 1.1.1.- from Serratia marcescens (see paper)
30% identity, 37% coverage: 438:696/699 of query aligns to 6:244/251 of H9XP47
- N15 (≠ G447) binding
- M17 (≠ I449) binding
- D36 (= D468) binding
- D60 (≠ N496) binding
- V61 (= V497) binding
- N87 (= N523) binding
- S138 (= S576) binding ; binding
- V139 (≠ K577) mutation to Q: Retains 50% of activity with acetoin as substrate; when associated with A-247.
- S140 (≠ N578) binding
- Y151 (= Y589) binding ; binding ; binding
- K155 (= K593) binding
- V184 (= V622) binding
- T186 (≠ R624) binding
- RDK 197:199 (≠ EAH 649:651) mutation to SEAAGKPLGYGTET: Mimics longer alpha6 helix. Retains 3% of activity with acetoin as substrate.
Sites not aligning to the query:
- 247 Q→A: Retains 10% of activity with acetoin as substrate. Retains 50% of activity with acetoin as substrate; when associated with Q-139.
6vspA Structure of serratia marcescens 2,3-butanediol dehydrogenase mutant q247a (see paper)
30% identity, 37% coverage: 438:696/699 of query aligns to 6:244/251 of 6vspA
- active site: G16 (= G448), S138 (= S576), Y151 (= Y589)
- binding nicotinamide-adenine-dinucleotide: G12 (= G444), N15 (≠ G447), G16 (= G448), M17 (≠ I449), D36 (= D468), W37 (≠ I469), W37 (≠ I469), A38 (≠ D470), I59 (≠ M495), D60 (≠ N496), V61 (= V497), N87 (= N523), A88 (= A524), G89 (= G525), V90 (≠ L526), V110 (≠ I546), T136 (≠ V574), S138 (= S576), Y151 (= Y589), K155 (= K593), P181 (= P619), S182 (≠ D620), L183 (≠ A621), V184 (= V622), T186 (≠ K627), N187 (≠ I628), M188 (≠ W629), T189 (= T630)
6vspB Structure of serratia marcescens 2,3-butanediol dehydrogenase mutant q247a (see paper)
30% identity, 37% coverage: 438:696/699 of query aligns to 8:246/252 of 6vspB
Query Sequence
>SMc02322 FitnessBrowser__Smeli:SMc02322
MLDKHQGARLANLWDDGKAAGMTEPEKLLYRSNLLGSDKRITNYGGGNTSAKVMEKDPLT
GEIVEVLWVKGSGGDVGTIKMDGFSTLYMDKLRALKGIYRGVEFEDEMVGYLPHCTFNLN
PRAASIDTPLHAYVPKPHVDHMHPDAIIAIAASKNSRELTSKIFGDEIGWLPWKRPGYEL
GLWLEKFCQENPDARGVVLESHGLFTWGDTAKEAYETTIEIINRAIAWFETENTGPAFGG
RSKPVLAAADRAAIAKKLMPVIRGLISAGESKVGHFDDSQAVLDFVTSTSLEPLAALGTS
CPDHFLRTKIRPLVVDFDPAQPDVGNTLAGLPEAIATYRADYAAYYERCKRADSPAMRDP
NAVVYLVPGVGMITFAKDKATARISAEFYVNAINVMRGASGVSTYVGLPEQEAFDIEYWL
LEEAKLQRMPKPKSLAGRIALVTGGAGGIGKATANRLMQEGACVVLADIDETALEAAQTE
LSTRYGKDFVRSVNMNVTSEAAVESGFGDALLAFGGLDILVSNAGLATSAAVEDTTLALW
NKNMDILATGYFLVSREAFRIFRNQKAGGNVVFVASKNGLAASPGASAYCTAKAAEIHLA
RCLALEGASAQIRVNVVNPDAVLRGSKIWTGEWKEQRAAAYKMDVDELEAHYRERSMLKL
SVFPEDIAEAIYFLASDMSAKSTGNIVNVDAGNAQSFTR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory