Comparing SMc02333 FitnessBrowser__Smeli:SMc02333 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
3ngjD Crystal structure of a putative deoxyribose-phosphate aldolase from entamoeba histolytica
34% identity, 88% coverage: 11:227/248 of query aligns to 2:217/222 of 3ngjD
Sites not aligning to the query:
1ub3A Crystal structure of tetrameric structure of aldolase from thermus thermophilus hb8 (see paper)
36% identity, 85% coverage: 18:227/248 of query aligns to 1:209/211 of 1ub3A
Q4ZMV1 Deoxyribose-phosphate aldolase; DERA; 2-deoxy-D-ribose 5-phosphate aldolase; Phosphodeoxyriboaldolase; Deoxyriboaldolase; EC 4.1.2.4 from Pseudomonas syringae pv. syringae (strain B728a) (see paper)
38% identity, 87% coverage: 13:227/248 of query aligns to 3:216/226 of Q4ZMV1
Q9Y315 Deoxyribose-phosphate aldolase; DERA; 2-deoxy-D-ribose 5-phosphate aldolase; Phosphodeoxyriboaldolase; Deoxyriboaldolase; EC 4.1.2.4 from Homo sapiens (Human) (see paper)
33% identity, 54% coverage: 79:211/248 of query aligns to 128:269/318 of Q9Y315
6z9iB Escherichia coli d-2-deoxyribose-5-phosphate aldolase - n21k mutant complex with reaction products (see paper)
28% identity, 68% coverage: 55:222/248 of query aligns to 47:224/248 of 6z9iB
Sites not aligning to the query:
P0A6L0 Deoxyribose-phosphate aldolase; DERA; 2-deoxy-D-ribose 5-phosphate aldolase; Phosphodeoxyriboaldolase; Deoxyriboaldolase; EC 4.1.2.4 from Escherichia coli (strain K12) (see 2 papers)
28% identity, 68% coverage: 55:222/248 of query aligns to 49:226/259 of P0A6L0
Sites not aligning to the query:
5el1A Crystal structure of deoxyribose-phosphate aldolase from escherichia coli (k58e-y96w mutant) after acetaldehyde treatment (see paper)
28% identity, 67% coverage: 55:220/248 of query aligns to 47:222/248 of 5el1A
Sites not aligning to the query:
5ekyA Crystal structure of deoxyribose-phosphate aldolase from escherichia coli (k58e-y96w mutant) (see paper)
28% identity, 67% coverage: 55:220/248 of query aligns to 47:222/248 of 5ekyA
Sites not aligning to the query:
1jcjA Observation of covalent intermediates in an enzyme mechanism at atomic resolution (see paper)
28% identity, 67% coverage: 55:220/248 of query aligns to 50:225/252 of 1jcjA
Sites not aligning to the query:
7p76A Re-engineered 2-deoxy-d-ribose-5-phosphate aldolase catalysing asymmetric michael addition reactions, schiff base complex with cinnamaldehyde (see paper)
28% identity, 80% coverage: 22:220/248 of query aligns to 11:221/247 of 7p76A
3qyqA 1.8 angstrom resolution crystal structure of a putative deoxyribose- phosphate aldolase from toxoplasma gondii me49 (see paper)
28% identity, 70% coverage: 13:186/248 of query aligns to 10:192/273 of 3qyqA
Sites not aligning to the query:
>SMc02333 FitnessBrowser__Smeli:SMc02333
MNNISNRRQPPASLAPRDLAALIDISAVQAFHTEADVRELAGIAVAEGFIAAHALPNFVP
LLRSLVPSGGLTLVGGPVGFPSGGHSTRTKTAEAVELAENGAQELDMMINVGRIKSGDFG
YVRSEIRAIVEAIAPVPLKVILELAHLTDEEIRAASAIVAESGAAFVKTGTGWTPSATTL
EKLKLIVETVGGAVEIKASGGIRSLDAIAGMMRLGVTRFGINTQVAVDLVRQCAALPGGR
LDIAGKAG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory