Comparing SMc02334 FitnessBrowser__Smeli:SMc02334 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P09099 Xylulose kinase; XK; Xylulokinase; 1-deoxy-D-xylulokinase; EC 2.7.1.17; EC 2.7.1.- from Escherichia coli (strain K12) (see paper)
30% identity, 96% coverage: 8:499/515 of query aligns to 5:478/484 of P09099
3ll3B The crystal structure of ligand bound xylulose kinase from lactobacillus acidophilus
27% identity, 98% coverage: 5:509/515 of query aligns to 4:484/490 of 3ll3B
3ll3A The crystal structure of ligand bound xylulose kinase from lactobacillus acidophilus
28% identity, 98% coverage: 5:509/515 of query aligns to 5:486/492 of 3ll3A
2itmA Crystal structure of the e. Coli xylulose kinase complexed with xylulose (see paper)
29% identity, 96% coverage: 8:499/515 of query aligns to 5:470/476 of 2itmA
5ya1A Crystal structure of lsrk-hpr complex with atp (see paper)
28% identity, 93% coverage: 7:487/515 of query aligns to 7:473/478 of 5ya1A
3kzbA Crystal structure of xylulokinase from chromobacterium violaceum
31% identity, 89% coverage: 5:464/515 of query aligns to 6:461/498 of 3kzbA
5ya2A Crystal structure of lsrk-hpr complex with adp (see paper)
28% identity, 93% coverage: 7:487/515 of query aligns to 7:473/478 of 5ya2A
6k76A Glycerol kinase form thermococcus kodakarensis, complex structure with substrate.
26% identity, 96% coverage: 5:496/515 of query aligns to 1:477/485 of 6k76A
O34154 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Enterococcus faecalis (strain ATCC 700802 / V583) (see 2 papers)
23% identity, 93% coverage: 5:484/515 of query aligns to 7:480/501 of O34154
Sites not aligning to the query:
P18157 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Bacillus subtilis (strain 168) (see paper)
22% identity, 94% coverage: 1:484/515 of query aligns to 1:477/496 of P18157
3ge1A 2.7 angstrom crystal structure of glycerol kinase (glpk) from staphylococcus aureus in complex with adp and glycerol
22% identity, 97% coverage: 1:498/515 of query aligns to 2:491/499 of 3ge1A
Q5HGD2 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Staphylococcus aureus (strain COL)
22% identity, 97% coverage: 1:498/515 of query aligns to 1:490/498 of Q5HGD2
P0A6F3 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Escherichia coli (strain K12) (see 10 papers)
22% identity, 97% coverage: 5:502/515 of query aligns to 7:501/502 of P0A6F3
Sites not aligning to the query:
1bu6Y Crystal structures of escherichia coli glycerol kinase and the mutant a65t in an inactive tetramer: conformational changes and implications for allosteric regulation (see paper)
22% identity, 97% coverage: 5:502/515 of query aligns to 5:499/499 of 1bu6Y
1glfO Crystal structures of escherichia coli glycerol kinase and the mutant a65t in an inactive tetramer: conformational changes and implications for allosteric regulation (see paper)
22% identity, 97% coverage: 5:501/515 of query aligns to 5:498/498 of 1glfO
1bo5O Crystal structure of the complex between escherichia coli glycerol kinase and the allosteric regulator fructose 1,6-bisphosphate. (see paper)
22% identity, 97% coverage: 5:501/515 of query aligns to 5:498/498 of 1bo5O
3qdkA Structural insight on mechanism and diverse substrate selection strategy of ribulokinase (see paper)
24% identity, 87% coverage: 9:458/515 of query aligns to 7:483/546 of 3qdkA
O34153 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Enterococcus casseliflavus (Enterococcus flavescens) (see 3 papers)
22% identity, 97% coverage: 3:502/515 of query aligns to 5:506/506 of O34153
3h3nX Glycerol kinase h232r with glycerol (see paper)
23% identity, 94% coverage: 3:487/515 of query aligns to 4:484/501 of 3h3nX
1gldG Cation promoted association (cpa) of a regulatory and target protein is controlled by phosphorylation (see paper)
22% identity, 97% coverage: 5:501/515 of query aligns to 3:489/489 of 1gldG
>SMc02334 FitnessBrowser__Smeli:SMc02334
MGDTVAAFDLGTGGVKAAIFRPDGTCIAEEVVSYRTFYPSPSCHEQRPEDWWEAICASLR
TLFENTAVKAGDIRAIAVSGHSLGCLPLDENGALLQEFVPIWSDGRAVAEAEDFFTRVDP
DTWYRTTGNGFPAPLYTVFKAMWLRRNAPDIFARTRTIIGTKDYINLRLTGRIATDPSYA
SGTGVYDLKAGRYSAELVEAAGLSRELFPPIVASTDVLGDVLPEIAERLGLFPGVKVVAG
GVDNSCMALGGRTFLEGDAYASMGSSSWITVSASEPLLDDRVRPFVFAHVAPGMFISATS
IFSSGTSFNWVTDTLLPDVKHAAKVAGMDVHDALFRLAGEAPAGARGLIFVPTLGGGTSF
EGGPAVRGGFVGLDLQHGRADILRATLEGVALGLRIALDELRRMTAIGPEMIIVGGGARS
AFWRQVFADVFDCAIVKTRVDQQAAALGAAALAFVGMGLWEDFLPIRTLHVAEGRTEPAP
EARKVYRAALAAYRRAAEQQHELSGALAALREAAT
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory