Comparing SMc02335 FitnessBrowser__Smeli:SMc02335 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P09099 Xylulose kinase; XK; Xylulokinase; 1-deoxy-D-xylulokinase; EC 2.7.1.17; EC 2.7.1.- from Escherichia coli (strain K12) (see paper)
29% identity, 81% coverage: 5:418/509 of query aligns to 1:409/484 of P09099
5ya1A Crystal structure of lsrk-hpr complex with atp (see paper)
29% identity, 92% coverage: 6:474/509 of query aligns to 5:472/478 of 5ya1A
5ya2A Crystal structure of lsrk-hpr complex with adp (see paper)
29% identity, 92% coverage: 6:474/509 of query aligns to 5:472/478 of 5ya2A
3ll3A The crystal structure of ligand bound xylulose kinase from lactobacillus acidophilus
24% identity, 96% coverage: 4:492/509 of query aligns to 3:488/492 of 3ll3A
2itmA Crystal structure of the e. Coli xylulose kinase complexed with xylulose (see paper)
28% identity, 81% coverage: 5:418/509 of query aligns to 1:401/476 of 2itmA
3ll3B The crystal structure of ligand bound xylulose kinase from lactobacillus acidophilus
24% identity, 96% coverage: 4:492/509 of query aligns to 2:486/490 of 3ll3B
6jafA Crystal structure of trypanosoma brucei gambiense glycerol kinase complex with ppi (pyrophosphatase reaction)
27% identity, 83% coverage: 8:430/509 of query aligns to 8:450/513 of 6jafA
6j9qA Crystal structure of trypanosoma brucei gambiense glycerol kinase complex with amp-pnp.
27% identity, 83% coverage: 8:430/509 of query aligns to 8:450/513 of 6j9qA
5aziA Crystal structure of glycerol kinase from trypanosoma brucei gambiense complexed with 4np (see paper)
27% identity, 83% coverage: 8:430/509 of query aligns to 8:450/513 of 5aziA
3wxlA Crystal structure of trypanosoma brucei gambiense glycerol kinase complex with adp, mg2+, and glycerol (see paper)
27% identity, 83% coverage: 8:430/509 of query aligns to 8:450/513 of 3wxlA
3wxjB Crystal structure of trypanosoma brucei gambiense glycerol kinase in complex with glycerol 3-phosphate (see paper)
27% identity, 83% coverage: 8:430/509 of query aligns to 8:450/513 of 3wxjB
5gn6A Crystal structure of glycerol kinase from trypanosoma brucei gambiense complexed with cumarin derivative-17b (see paper)
27% identity, 83% coverage: 8:430/509 of query aligns to 8:450/513 of 5gn6A
5gn5A Crystal structure of glycerol kinase from trypanosoma brucei gambiense complexed with cumarin derivative-17 (see paper)
27% identity, 83% coverage: 8:430/509 of query aligns to 8:450/513 of 5gn5A
Q9NJP9 Glycerol kinase, glycosomal; GK; Glycerokinase; ATP:glycerol 3-phosphotransferase; EC 2.7.1.30 from Trypanosoma brucei brucei (see 2 papers)
27% identity, 83% coverage: 8:430/509 of query aligns to 6:448/512 of Q9NJP9
Sites not aligning to the query:
1bu6Y Crystal structures of escherichia coli glycerol kinase and the mutant a65t in an inactive tetramer: conformational changes and implications for allosteric regulation (see paper)
25% identity, 89% coverage: 4:458/509 of query aligns to 3:464/499 of 1bu6Y
1glfO Crystal structures of escherichia coli glycerol kinase and the mutant a65t in an inactive tetramer: conformational changes and implications for allosteric regulation (see paper)
25% identity, 89% coverage: 4:458/509 of query aligns to 3:464/498 of 1glfO
1bo5O Crystal structure of the complex between escherichia coli glycerol kinase and the allosteric regulator fructose 1,6-bisphosphate. (see paper)
25% identity, 89% coverage: 4:458/509 of query aligns to 3:464/498 of 1bo5O
P0A6F3 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Escherichia coli (strain K12) (see 10 papers)
25% identity, 89% coverage: 4:458/509 of query aligns to 5:466/502 of P0A6F3
Sites not aligning to the query:
P18157 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Bacillus subtilis (strain 168) (see paper)
24% identity, 89% coverage: 7:457/509 of query aligns to 6:463/496 of P18157
1gllO Escherichia coli glycerol kinase mutant with bound atp analog showing substantial domain motion (see paper)
25% identity, 89% coverage: 4:458/509 of query aligns to 3:460/494 of 1gllO
>SMc02335 FitnessBrowser__Smeli:SMc02335
MTGELFLAIDVGTGSVRAALIDTRGKIVEIAAREHDQIVPQFGWAEQRPLDWWEGACTAV
RTVLDKAEGARERISIIAVCGQMHGLVLIDDAGQLTRDTAPLWNDKRTLNLVRRFEAENE
PDSYLAESGNTPTPAWPGFKLQWVRDADPGAYRRSAVAIMPKDYINFRLTGEIAMDTGDA
SCSFLMNPATLAWSPAMIERMGLDARLLPPIRNPLEIIGRVTDQAALATGLTAGTPVMVG
GADYPMALLGSGVCRPGLGSDSTGTGAIVTMIADKPLLDPEISNVATIEGNWAPFVLLET
GGDGMRWARRAFHDGALSYGDIVARAEKAPAGCEALLFMPFLTGERLGQHRNARAQFFGL
GAGHGMEHLHRAILEGIAFAMARHIRIMEHSSGKRLERMIAAGGGARTKLWLKIKASVFD
TPVLVPQEPECGLMGCAAMAATATGRFSRPDDAADAYVRYADEIAPDPAWVEVYSHVQPV
FDRLYHHSMALYDDMDALAARIHPPGTRT
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory