Comparing SMc02337 FitnessBrowser__Smeli:SMc02337 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
41% identity, 99% coverage: 1:498/501 of query aligns to 1:501/501 of P04983
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
30% identity, 43% coverage: 4:217/501 of query aligns to 2:216/241 of 4u00A
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
28% identity, 43% coverage: 4:217/501 of query aligns to 1:216/240 of 4ymuJ
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
32% identity, 43% coverage: 1:216/501 of query aligns to 1:222/648 of P75831
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
29% identity, 43% coverage: 1:213/501 of query aligns to 14:224/378 of P69874
Sites not aligning to the query:
2pclA Crystal structure of abc transporter with complex (aq_297) from aquifex aeolicus vf5
30% identity, 41% coverage: 10:216/501 of query aligns to 9:217/223 of 2pclA
5ws4A Crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii (see paper)
30% identity, 46% coverage: 4:231/501 of query aligns to 4:245/650 of 5ws4A
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
30% identity, 41% coverage: 10:214/501 of query aligns to 10:227/254 of 1g6hA
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
30% identity, 41% coverage: 10:214/501 of query aligns to 10:227/253 of 1g9xB
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
30% identity, 42% coverage: 5:214/501 of query aligns to 7:220/375 of 2d62A
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
30% identity, 42% coverage: 4:214/501 of query aligns to 1:222/232 of 1f3oA
3c4jA Abc protein artp in complex with atp-gamma-s
27% identity, 43% coverage: 4:217/501 of query aligns to 3:218/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
27% identity, 43% coverage: 4:217/501 of query aligns to 3:218/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
27% identity, 43% coverage: 4:217/501 of query aligns to 3:218/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
27% identity, 43% coverage: 4:217/501 of query aligns to 3:218/242 of 2oljA
7mdyC Lolcde nucleotide-bound
32% identity, 42% coverage: 3:213/501 of query aligns to 1:218/226 of 7mdyC
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
32% identity, 42% coverage: 3:213/501 of query aligns to 4:221/233 of P75957
7arlD Lolcde in complex with lipoprotein and adp (see paper)
32% identity, 42% coverage: 3:213/501 of query aligns to 1:218/222 of 7arlD
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
30% identity, 48% coverage: 5:245/501 of query aligns to 4:245/369 of P19566
Sites not aligning to the query:
6z4wA Ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) (see paper)
27% identity, 43% coverage: 1:213/501 of query aligns to 1:215/230 of 6z4wA
>SMc02337 FitnessBrowser__Smeli:SMc02337
MTVLVSLSGISKNFSGVQALKGVDFDLRAGEVHALVGENGAGKSTLMRVLAGEMKPTSGT
VSIHGETMQHSGPRGAAGRGISVIHQELALAPDLTVAENIFLGRLPRIVNHRRLRKAASE
ILERLGFDIDPAIHAGRLTVAHQQVVEIAKALSNRARIIVFDEPTAVLANTDAERLLAII
RELRAGGTGAVYISHRLNEVFDLSDRITVMKDGSHVETLETSATDVDAVIARMVGRQMSA
LFPSKAGRVPGEVVVRVRNVSRGRKVRDVSFSVRAGEVVGLGGLVGSGRTEVARLVFGAD
KMDSGTVELNGKPLHLSSPREAVRARIGLVPEDRKQQGVILDAPIRINTTLAKIRSISRL
GFLDAGKERQVAVALGAEMRLKASSVDAPVSSLSGGNQQKVALAKWFHADCDLLILDEPT
RGVDVGAKGEIYNLINDLAKAGKAILVISSEHQELFGICDRVLVMAEGAIVGELTESKFT
EQQLLTLAMTRSARERDETSQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory