Comparing SMc02358 FitnessBrowser__Smeli:SMc02358 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1ji0A Crystal structure analysis of the abc transporter from thermotoga maritima
50% identity, 100% coverage: 1:234/235 of query aligns to 6:238/240 of 1ji0A
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
32% identity, 90% coverage: 11:221/235 of query aligns to 14:236/254 of 1g6hA
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
33% identity, 100% coverage: 1:234/235 of query aligns to 2:235/240 of 6mjpA
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
31% identity, 94% coverage: 1:221/235 of query aligns to 4:236/253 of 1g9xB
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
36% identity, 99% coverage: 2:234/235 of query aligns to 3:235/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
36% identity, 99% coverage: 2:234/235 of query aligns to 3:235/238 of 6s8gA
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
36% identity, 99% coverage: 2:234/235 of query aligns to 3:235/235 of 6mhzA
6mbnA Lptb e163q in complex with atp (see paper)
35% identity, 99% coverage: 2:234/235 of query aligns to 4:236/241 of 6mbnA
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
35% identity, 99% coverage: 2:233/235 of query aligns to 3:234/234 of 6b89A
4p31A Crystal structure of a selenomethionine derivative of e. Coli lptb in complex with adp-magensium (see paper)
35% identity, 99% coverage: 2:233/235 of query aligns to 3:234/234 of 4p31A
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
34% identity, 88% coverage: 16:221/235 of query aligns to 267:481/501 of P04983
Sites not aligning to the query:
6b8bA E. Coli lptb in complex with adp and a novobiocin derivative (see paper)
36% identity, 94% coverage: 2:222/235 of query aligns to 3:223/233 of 6b8bA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
31% identity, 99% coverage: 1:233/235 of query aligns to 1:236/240 of 4ymuJ
4yerA Crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution
33% identity, 94% coverage: 4:223/235 of query aligns to 7:224/285 of 4yerA
P55339 ABC-type transporter ATP-binding protein EcsA from Bacillus subtilis (strain 168) (see paper)
32% identity, 95% coverage: 1:223/235 of query aligns to 3:222/247 of P55339
3d31A Modbc from methanosarcina acetivorans (see paper)
35% identity, 94% coverage: 1:222/235 of query aligns to 1:215/348 of 3d31A
Sites not aligning to the query:
3c4jA Abc protein artp in complex with atp-gamma-s
29% identity, 94% coverage: 1:222/235 of query aligns to 3:225/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
29% identity, 94% coverage: 1:222/235 of query aligns to 3:225/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
29% identity, 94% coverage: 1:222/235 of query aligns to 3:225/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
29% identity, 94% coverage: 1:222/235 of query aligns to 3:225/242 of 2oljA
>SMc02358 FitnessBrowser__Smeli:SMc02358
MLDVTDLSVSYGAIRAVRSISFTLRKGELVSLLGANGAGKSSTIKCIAGALKASGGTITL
EGKDITAASPEQVVRAGLATVPETRDVFPDLTVAENLMLGAFIHRRDQAGNRDNLEKLNT
LFPRLAERSKQAAGTLSGGEQQMLVIARALMARPRVLLLDEPSLGLAPAIVERIFEMIET
LKKSGLTILLVEQNVNQALAVADRAFVMRLGAIVASGTAEEIRSTSDLSAHYLGG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory