Comparing SMc02393 FitnessBrowser__Smeli:SMc02393 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4wbtA Crystal structure of histidinol-phosphate aminotransferase from sinorhizobium meliloti in complex with pyridoxal-5'-phosphate
99% identity, 99% coverage: 1:371/373 of query aligns to 4:369/369 of 4wbtA
4r5zA Crystal structure of rv3772 encoded aminotransferase (see paper)
35% identity, 83% coverage: 5:314/373 of query aligns to 3:305/353 of 4r5zA
4r2nA Crystal structure of rv3772 in complex with its substrate (see paper)
35% identity, 83% coverage: 5:314/373 of query aligns to 3:305/353 of 4r2nA
Sites not aligning to the query:
8bj3A Crystal structure of medicago truncatula histidinol-phosphate aminotransferase (hisn6) in complex with histidinol-phosphate (see paper)
28% identity, 92% coverage: 19:363/373 of query aligns to 16:356/360 of 8bj3A
Sites not aligning to the query:
3ly1D Crystal structure of putative histidinol-phosphate aminotransferase (yp_050345.1) from erwinia carotovora atroseptica scri1043 at 1.80 a resolution
29% identity, 88% coverage: 37:365/373 of query aligns to 20:347/354 of 3ly1D
3cq5B Histidinol-phosphate aminotransferase from corynebacterium glutamicum in complex with pmp (see paper)
27% identity, 86% coverage: 37:357/373 of query aligns to 31:356/366 of 3cq5B
3cq6A Histidinol-phosphate aminotransferase from corynebacterium glutamicum holo-form (plp covalently bound ) (see paper)
27% identity, 86% coverage: 37:357/373 of query aligns to 29:354/364 of 3cq6A
Sites not aligning to the query:
P0DV65 L-serine phosphate decarboxylase; CobD homolog SMUL_1544; SmCobD; L-serine O-phosphate decarboxylase; L-Ser-P decarboxylase; Norcobamide biosynthesis protein SMUL_1544; Threonine phosphate decarboxylase-like enzyme; EC 4.1.1.- from Sulfurospirillum multivorans (strain DM 12446 / JCM 15788 / NBRC 109480) (see paper)
24% identity, 80% coverage: 69:368/373 of query aligns to 82:389/392 of P0DV65
Sites not aligning to the query:
2f8jA Crystal structure of histidinol-phosphate aminotransferase (ec 2.6.1.9) (imidazole acetol-phosphate transferase) (tm1040) from thermotoga maritima at 2.40 a resolution
26% identity, 73% coverage: 38:310/373 of query aligns to 25:287/335 of 2f8jA
1uu1A Complex of histidinol-phosphate aminotransferase (hisc) from thermotoga maritima (apo-form) (see paper)
26% identity, 73% coverage: 38:310/373 of query aligns to 19:281/329 of 1uu1A
Sites not aligning to the query:
1h1cA Histidinol-phosphate aminotransferase (hisc) from thermotoga maritima (see paper)
26% identity, 73% coverage: 38:310/373 of query aligns to 19:281/329 of 1h1cA
Q9X0D0 Histidinol-phosphate aminotransferase; Imidazole acetol-phosphate transaminase; EC 2.6.1.9 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
26% identity, 73% coverage: 38:310/373 of query aligns to 24:286/335 of Q9X0D0
1uu0A Histidinol-phosphate aminotransferase (hisc) from thermotoga maritima (apo-form) (see paper)
26% identity, 73% coverage: 38:310/373 of query aligns to 18:280/328 of 1uu0A
4r8dA Crystal structure of rv1600 encoded aminotransferase in complex with plp-mes from mycobacterium tuberculosis
26% identity, 89% coverage: 9:339/373 of query aligns to 10:337/369 of 4r8dA
7szpA Crystal structure of histidinol-phosphate aminotransferase from klebsiella pneumoniae subsp. Pneumoniae (strain hs11286)
27% identity, 80% coverage: 64:363/373 of query aligns to 52:349/353 of 7szpA
1geyA Crystal structure of histidinol-phosphate aminotransferase complexed with n-(5'-phosphopyridoxyl)-l-glutamate (see paper)
25% identity, 91% coverage: 26:363/373 of query aligns to 5:335/335 of 1geyA
1fg7A Crystal structure of l-histidinol phosphate aminotransferase with pyridoxal-5'-phosphate (see paper)
25% identity, 80% coverage: 64:363/373 of query aligns to 52:349/354 of 1fg7A
1fg3A Crystal structure of l-histidinol phosphate aminotransferase complexed with l-histidinol (see paper)
25% identity, 80% coverage: 64:363/373 of query aligns to 52:349/354 of 1fg3A
Sites not aligning to the query:
1o4sB Crystal structure of aspartate aminotransferase (tm1255) from thermotoga maritima at 1.90 a resolution (see paper)
25% identity, 61% coverage: 47:275/373 of query aligns to 52:294/384 of 1o4sB
2o1bA Structure of aminotransferase from staphylococcus aureus
27% identity, 57% coverage: 155:366/373 of query aligns to 152:371/376 of 2o1bA
Sites not aligning to the query:
>SMc02393 FitnessBrowser__Smeli:SMc02393
MSAFSRFTPLIQSLPASVPFVGPEALERQHGRKIAARIGANESGFGPAPSVLLAIRQAAG
DTWKYADPENHDLKQALARHLGTSPANIAIGEGIDGLLGQIVRLVVEAGAPVVTSLGGYP
TFNYHVAGHGGRLVTVPYADDREDLEGLLAAVGRENAPLVYLANPDNPMGSWWPAERVVA
FAQALPETTLLVLDEAYCETAPRDALPPIESLIDKPNVIRARTFSKAYGLAGARIGYTLS
TPGTAQAFDKIRNHFGMSRIGVAAAIAALADQDYLKEVTLKIANSRQRIGRIAADSGLAP
LPSATNFVAVDCGKDASYARAIVDRLMSDHGIFIRMPGVAPLNRCIRISTAPDAEMDLLA
AALPEVIRSLAAT
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory