Comparing SMc02472 FitnessBrowser__Smeli:SMc02472 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
7cagA Mycobacterium smegmatis lpqy-sugabc complex in the catalytic intermediate state (see paper)
31% identity, 86% coverage: 40:308/312 of query aligns to 16:279/285 of 7cagA
P94529 Arabinooligosaccharides transport system permease protein AraP from Bacillus subtilis (strain 168) (see paper)
29% identity, 92% coverage: 4:290/312 of query aligns to 5:288/313 of P94529
4ki0F Crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to maltohexaose (see paper)
23% identity, 80% coverage: 52:301/312 of query aligns to 219:487/490 of 4ki0F
P02916 Maltose/maltodextrin transport system permease protein MalF from Escherichia coli (strain K12) (see 4 papers)
24% identity, 77% coverage: 74:312/312 of query aligns to 259:514/514 of P02916
>SMc02472 FitnessBrowser__Smeli:SMc02472
MTDATATMTAVPATASRKNVRYKSPTVRGRLPVLILFLPPALLLFTVFVILPMGEAAWYS
LYRWNGYGTPTQFVGLRNFEVLFNNAAFSRALINNGIIILVSVLLQIPLALWLAMMLAHR
IAGVVAFRLIFFLPYVLADVAAGLIWRFVYDGDYGLVAAIAGFFGVATPYVLADRSLAIY
AVLAVIIWKYFGFHMMLFIAGLQAVDRSVLEAAEIDGATGWQKFRYVTLPLLGSTVRLSI
FFAVIGSLQLFDLVMPLTGGGPSNSTQTMVTFLYTYGVTRMQVGLGSAVGVVLFVICVTL
AFGYKRIFMRHD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory