SitesBLAST
Comparing SMc02486 FitnessBrowser__Smeli:SMc02486 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4iqgD Crystal structure of bpro0239 oxidoreductase from polaromonas sp. Js666 in NADP bound form
65% identity, 98% coverage: 5:250/250 of query aligns to 3:248/248 of 4iqgD
- active site: G13 (= G15), N112 (= N114), S143 (= S145), Y154 (= Y156), Y157 (= Y159), K161 (= K163)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G9 (= G11), S11 (= S13), R12 (= R14), G13 (= G15), I14 (= I16), N32 (= N34), A34 (= A36), S35 (= S37), N36 (= N38), A59 (≠ G61), D60 (≠ N62), V61 (= V63), N87 (= N89), A88 (= A90), G89 (= G91), V141 (≠ L143), S143 (= S145), Y157 (= Y159), K161 (= K163), P187 (= P189), G188 (= G190), I190 (= I192), T192 (= T194), I194 (= I196), H195 (= H197)
8bcjB Crystal structure of short-chain dehydrogenase pa3128 from pseudomonas aeruginosa pao1 in complex with NADP+
60% identity, 98% coverage: 6:250/250 of query aligns to 6:250/250 of 8bcjB
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G11), S13 (= S13), R14 (= R14), G15 (= G15), I16 (= I16), L36 (≠ A36), R37 (≠ S37), N38 (= N38), A61 (≠ G61), D62 (≠ N62), V63 (= V63), N89 (= N89), A90 (= A90), G91 (= G91), T113 (≠ V113), V143 (≠ L143), S145 (= S145), Y159 (= Y159), K163 (= K163), P189 (= P189), G190 (= G190), I192 (= I192), T194 (= T194), I196 (= I196), H197 (= H197)
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
39% identity, 97% coverage: 8:249/250 of query aligns to 8:243/246 of 3osuA
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
38% identity, 97% coverage: 8:249/250 of query aligns to 5:236/239 of 3sj7A
- active site: G12 (= G15), S138 (= S145), Q148 (= Q155), Y151 (= Y159), K155 (= K163)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G11), S10 (= S13), R11 (= R14), I13 (= I16), N31 (= N34), Y32 (= Y35), A33 (= A36), G34 (≠ S37), S35 (≠ N38), A58 (≠ G61), N59 (= N62), V60 (= V63), N86 (= N89), A87 (= A90), T109 (≠ V113), S138 (= S145), Y151 (= Y159), K155 (= K163), P181 (= P189), G182 (= G190)
7v0hG Crystal structure of putative glucose 1-dehydrogenase from burkholderia cenocepacia in complex with NADP and a potential reaction product
41% identity, 98% coverage: 4:249/250 of query aligns to 11:251/253 of 7v0hG
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G11), S20 (= S13), K21 (≠ R14), G22 (= G15), I23 (= I16), A43 (= A36), S44 (= S37), S45 (≠ N38), G68 (= G61), D69 (≠ N62), V70 (= V63), N96 (= N89), S97 (≠ A90), G98 (= G91), Y100 (vs. gap), I144 (≠ L143), S146 (= S145), Y159 (= Y159), K163 (= K163), P189 (= P189), G190 (= G190), M191 (≠ I191), I192 (= I192), T194 (= T194), G196 (≠ I196), T197 (≠ H197)
- binding (2R)-2-(hydroxymethyl)pentanedioic acid: S146 (= S145), Y159 (= Y159), M191 (≠ I191), I202 (≠ L202)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
36% identity, 98% coverage: 4:249/250 of query aligns to 5:244/247 of 4jroC
- active site: G16 (= G15), S142 (= S145), Q152 (= Q155), Y155 (= Y159), K159 (= K163)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G11), S14 (= S13), R15 (= R14), G16 (= G15), I17 (= I16), N35 (= N34), Y36 (= Y35), N37 (≠ A36), G38 (≠ S37), S39 (≠ N38), N63 (= N62), V64 (= V63), N90 (= N89), A91 (= A90), I93 (= I92), I113 (≠ V113), S142 (= S145), Y155 (= Y159), K159 (= K163), P185 (= P189), I188 (= I192), T190 (= T194)
1edoA The x-ray structure of beta-keto acyl carrier protein reductase from brassica napus complexed with NADP+ (see paper)
37% identity, 98% coverage: 5:249/250 of query aligns to 2:241/244 of 1edoA
- active site: G12 (= G15), S138 (= S145), Y151 (= Y159), K155 (= K163)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G11), S10 (= S13), R11 (= R14), I13 (= I16), N31 (= N34), Y32 (= Y35), A33 (= A36), R34 (≠ S37), S35 (≠ N38), D59 (≠ N62), V60 (= V63), N86 (= N89), A87 (= A90), S138 (= S145), Y151 (= Y159), K155 (= K163), P181 (= P189), G182 (= G190), I184 (= I192), S186 (≠ T194), M188 (≠ I196)
3ijrF 2.05 angstrom resolution crystal structure of a short chain dehydrogenase from bacillus anthracis str. 'Ames ancestor' in complex with NAD+
34% identity, 98% coverage: 4:249/250 of query aligns to 46:285/290 of 3ijrF
- active site: G57 (= G15), S182 (= S145), L192 (≠ Y156), Y195 (= Y159), K199 (= K163), K240 (≠ D204)
- binding magnesium ion: D55 (≠ S13), S56 (≠ R14), E80 (≠ N38)
- binding nicotinamide-adenine-dinucleotide: D55 (≠ S13), S56 (≠ R14), G57 (= G15), I58 (= I16), Y77 (= Y35), L78 (≠ A36), E80 (≠ N38), G103 (= G61), D104 (≠ N62), L105 (≠ V63), N131 (= N89), V132 (≠ A90), A133 (≠ G91), Q134 (≠ I92), I155 (≠ V113), T180 (≠ L143), S182 (= S145), Y195 (= Y159), K199 (= K163), P225 (= P189), G226 (= G190), P227 (≠ I191), I228 (= I192), T230 (= T194), L232 (≠ I196)
Sites not aligning to the query:
3i3oA 2.06 angstrom resolution crystal structure of a short chain dehydrogenase from bacillus anthracis str. 'Ames ancestor' in complex with NAD-acetone
34% identity, 98% coverage: 4:249/250 of query aligns to 38:277/282 of 3i3oA
- active site: G49 (= G15), S174 (= S145), L184 (≠ Y156), Y187 (= Y159), K191 (= K163), K232 (≠ D204)
- binding magnesium ion: D47 (≠ S13), S48 (≠ R14), E72 (≠ N38)
- binding nicotinamide adenine dinucleotide acetone adduct: G45 (= G11), D47 (≠ S13), S48 (≠ R14), G49 (= G15), I50 (= I16), Y69 (= Y35), L70 (≠ A36), E72 (≠ N38), G95 (= G61), D96 (≠ N62), L97 (≠ V63), N123 (= N89), V124 (≠ A90), A125 (≠ G91), Q126 (≠ I92), Q127 (≠ I93), I147 (≠ V113), T172 (≠ L143), S174 (= S145), Y187 (= Y159), K191 (= K163), P217 (= P189), G218 (= G190), I220 (= I192), T222 (= T194), L224 (≠ I196)
3iccA Crystal structure of a putative 3-oxoacyl-(acyl carrier protein) reductase from bacillus anthracis at 1.87 a resolution (see paper)
35% identity, 100% coverage: 1:249/250 of query aligns to 4:252/255 of 3iccA
- active site: G18 (= G15), S148 (= S145), F158 (≠ Y156), Y161 (= Y159), K165 (= K163)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G14 (= G11), S16 (= S13), R17 (= R14), G18 (= G15), I19 (= I16), H37 (≠ N34), Y38 (= Y35), G39 (≠ A36), L66 (≠ V63), E67 (≠ G64), N98 (= N89), G100 (= G91), I146 (≠ L143), S148 (= S145), Y161 (= Y159), K165 (= K163), P191 (= P189), G192 (= G190), M198 (≠ I196), N199 (≠ H197)
3ay6B Crystal structure of bacillus megaterium glucose dehydrogenase 4 a258f mutant in complex with nadh and d-glucose (see paper)
36% identity, 98% coverage: 6:249/250 of query aligns to 15:255/267 of 3ay6B
- active site: G24 (= G15), S151 (= S145), Y164 (= Y159), K168 (= K163)
- binding beta-D-glucopyranose: E102 (≠ I93), S151 (= S145), H153 (≠ A147), W158 (≠ A152), Y164 (= Y159), N202 (≠ H197), K205 (≠ G200)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G20 (= G11), T23 (≠ R14), G24 (= G15), L25 (≠ I16), Y45 (≠ A36), D71 (≠ N62), V72 (= V63), N98 (= N89), A99 (= A90), G100 (= G91), V101 (≠ I92), M149 (≠ L143), S151 (= S145), Y164 (= Y159), K168 (= K163), P194 (= P189), G195 (= G190), M197 (≠ I192), T199 (= T194), P200 (≠ E195), I201 (= I196), N202 (≠ H197)
1g6kA Crystal structure of glucose dehydrogenase mutant e96a complexed with NAD+
35% identity, 99% coverage: 3:249/250 of query aligns to 6:249/261 of 1g6kA
- active site: G18 (= G15), S145 (= S145), Y158 (= Y159), K162 (= K163)
- binding nicotinamide-adenine-dinucleotide: T17 (≠ R14), G18 (= G15), L19 (≠ I16), R39 (≠ A36), D65 (≠ N62), V66 (= V63), N92 (= N89), A93 (= A90), G94 (= G91), M143 (≠ L143), S145 (= S145), Y158 (= Y159), P188 (= P189), G189 (= G190), I191 (= I192), T193 (= T194)
P40288 Glucose 1-dehydrogenase; EC 1.1.1.47 from Priestia megaterium (Bacillus megaterium) (see 2 papers)
35% identity, 99% coverage: 3:249/250 of query aligns to 6:249/261 of P40288
- 11:35 (vs. 8:32, 36% identical) binding
- E96 (≠ I93) mutation E->A,G,K: Heat stable.
- D108 (≠ R106) mutation to N: Heat stable.
- V112 (≠ L110) mutation to A: Heat stable.
- E133 (≠ H133) mutation to K: Heat stable.
- V183 (= V184) mutation to I: Heat stable.
- P194 (≠ E195) mutation to Q: Heat stable.
- E210 (≠ A210) mutation to K: Heat stable.
- Y217 (≠ R217) mutation to H: Heat stable.
Sites not aligning to the query:
- 252 Q→L: Heat stable.
- 253 Y→C: Heat stable.
- 258 A→G: Heat stable.
3r3sA Structure of the ygha oxidoreductase from salmonella enterica
38% identity, 97% coverage: 8:250/250 of query aligns to 51:289/292 of 3r3sA
- active site: G58 (= G15), S184 (= S145), L194 (≠ Y156), Y197 (= Y159), K201 (= K163), Q242 (≠ P203)
- binding magnesium ion: D56 (≠ S13), S57 (≠ R14), E82 (≠ N38)
- binding nicotinamide-adenine-dinucleotide: D56 (≠ S13), S57 (≠ R14), G58 (= G15), I59 (= I16), L79 (vs. gap), E82 (≠ N38), D106 (≠ N62), L107 (≠ V63), V133 (≠ N89), A134 (= A90), G135 (= G91), S184 (= S145), Y197 (= Y159), K201 (= K163), P227 (= P189), G228 (= G190), I230 (= I192), T232 (= T194), L234 (≠ I196), Q235 (≠ H197)
P73574 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-acyl carrier protein reductase; EC 1.1.1.100 from Synechocystis sp. (strain PCC 6803 / Kazusa) (see paper)
38% identity, 98% coverage: 6:249/250 of query aligns to 8:243/247 of P73574
- A14 (≠ G12) mutation to G: 4.2-fold increase in activity on acetoacetyl-CoA.
- P151 (= P153) mutation to F: 2.7-fold increase in activity on acetoacetyl-CoA.; mutation to V: 5.7-fold increase in activity on acetoacetyl-CoA.
- K160 (= K163) mutation to A: Almost no activity on acetoacetyl-CoA.
- F188 (≠ I191) mutation to Y: 3.3-fold increase in activity on acetoacetyl-CoA.
- N198 (≠ R205) mutation to R: 3.5-fold increase in activity on acetoacetyl-CoA.
P0AG84 Uncharacterized oxidoreductase YghA; EC 1.-.-.- from Escherichia coli (strain K12) (see paper)
36% identity, 97% coverage: 8:250/250 of query aligns to 53:291/294 of P0AG84
Sites not aligning to the query:
- 39 modified: N6-acetyllysine
6ypzAAA Monooxygenase (see paper)
36% identity, 97% coverage: 8:249/250 of query aligns to 9:250/253 of 6ypzAAA
- active site: G16 (= G15), S148 (= S145), Y161 (= Y159)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G12 (= G11), S14 (= S13), R15 (= R14), G16 (= G15), I17 (= I16), H35 (≠ N34), A37 (= A36), S38 (= S37), N39 (= N38), L64 (≠ V63), N96 (= N89), A97 (= A90), A98 (≠ G91), T100 (≠ I93), I146 (≠ L143), S147 (= S144), S148 (= S145), Y161 (= Y159), K165 (= K163), P191 (= P189), G192 (= G190), I193 (= I191), T194 (≠ I192), N196 (≠ S199)
6yq0AAA Monooxygenase (see paper)
36% identity, 97% coverage: 8:249/250 of query aligns to 9:250/254 of 6yq0AAA
- active site: G16 (= G15), S148 (= S145), Y161 (= Y159)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G11), S14 (= S13), R15 (= R14), G16 (= G15), I17 (= I16), H35 (≠ N34), A37 (= A36), S38 (= S37), N39 (= N38), L64 (≠ V63), N96 (= N89), A97 (= A90), A98 (≠ G91), T100 (≠ I93), R117 (≠ Q109), I146 (≠ L143), S147 (= S144), S148 (= S145), Y161 (= Y159), K165 (= K163), P191 (= P189), G192 (= G190), I193 (= I191), T194 (≠ I192), N196 (≠ S199)
- binding (3~{R})-8-methoxy-3-methyl-3-oxidanyl-2,4-dihydrobenzo[a]anthracene-1,7,12-trione: T100 (≠ I93), G101 (= G94), S148 (= S145), G149 (≠ I146), L150 (≠ A147), C153 (≠ L150), Q158 (= Q155), Y161 (= Y159), G192 (= G190), I193 (= I191)
Sites not aligning to the query:
5iz4A Crystal structure of a putative short-chain dehydrogenase/reductase from burkholderia xenovorans
36% identity, 99% coverage: 2:249/250 of query aligns to 2:243/247 of 5iz4A
- active site: G15 (= G15), S150 (= S145), S159 (≠ Q155), Y163 (= Y159), K167 (= K163)
- binding adenosine-5'-diphosphate: G11 (= G11), S14 (≠ R14), G15 (= G15), I16 (= I16), F36 (≠ Y35), A63 (≠ G61), D64 (≠ N62), V65 (= V63), A92 (= A90), G93 (= G91), V117 (= V113)
4dmmB 3-oxoacyl-[acyl-carrier-protein] reductase from synechococcus elongatus pcc 7942 in complex with NADP
40% identity, 98% coverage: 6:249/250 of query aligns to 7:236/240 of 4dmmB
- active site: G16 (= G15), S142 (= S145), Q152 (= Q155), Y155 (= Y159), K159 (= K163)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G11), S14 (= S13), R15 (= R14), G16 (= G15), I17 (= I16), A37 (= A36), S38 (= S37), S39 (≠ N38), A62 (≠ G61), D63 (≠ N62), V64 (= V63), N90 (= N89), A91 (= A90), L113 (≠ V113), I140 (≠ L143), S142 (= S145), Y155 (= Y159), K159 (= K163), P185 (= P189), G186 (= G190), I188 (= I192), T190 (= T194), M192 (≠ I196)
Query Sequence
>SMc02486 FitnessBrowser__Smeli:SMc02486
MSDGPVLLVTGGSRGIGAAVALAAASEGWRVAVNYASNRDAAEDVVRRIAEAGGTAVSVE
GNVGREEGVRAIFAAVDTAFGRLDGLVNNAGIIGPPQRVDEVSPERIEQLFRVNVTGSIR
CAAEAVLRMSARHGGRGGSIVNLSSIAAVLGAPGQYVDYAATKGAIDSFTVGLAREVATE
GIRVNAVRPGIIDTEIHASGGLPDRARDLAPTIPIQRPGTAGEVADAILYLLSDKATYVT
GTILTVSGGR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory