SitesBLAST
Comparing SMc02581 FitnessBrowser__Smeli:SMc02581 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5vfbA 1.36 angstrom resolution crystal structure of malate synthase g from pseudomonas aeruginosa in complex with glycolic acid.
67% identity, 100% coverage: 2:722/723 of query aligns to 2:723/724 of 5vfbA
5oasA Crystal structure of malate synthase g from pseudomonas aeruginosa in apo form. (see paper)
67% identity, 100% coverage: 2:722/723 of query aligns to 6:727/728 of 5oasA
P9WK16 Malate synthase G; EC 2.3.3.9 from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) (see paper)
63% identity, 99% coverage: 2:720/723 of query aligns to 3:724/741 of P9WK16
- R339 (= R338) active site, Proton acceptor
- D633 (= D629) active site, Proton donor
2gq3A Mycobacterium tuberculosis malate synthase in complex with magnesium, malate, and coenzyme a (see paper)
63% identity, 99% coverage: 2:720/723 of query aligns to 2:717/720 of 2gq3A
- active site: D267 (= D270), E269 (= E272), R335 (= R338), E430 (= E430), D458 (= D458), D626 (= D629)
- binding coenzyme a: V114 (= V116), V115 (= V117), R121 (= R123), F122 (≠ Y124), N125 (= N127), A126 (= A128), K301 (= K304), R308 (= R311), P539 (= P539), P541 (= P541), C612 (= C615), M624 (= M627), D626 (= D629)
- binding magnesium ion: H370 (= H373), K373 (≠ G376), N378 (= N378), G379 (= G379), L381 (≠ R381), E430 (= E430), D458 (= D458)
6axeA Crystal structure of a malate synthase g from mycobacterium marinum bound to acetyl coa
63% identity, 100% coverage: 2:722/723 of query aligns to 4:729/729 of 6axeA
- active site: D272 (= D270), E274 (= E272), R338 (= R338), E437 (= E430), D465 (= D458), D636 (= D629)
- binding acetyl coenzyme *a: V119 (= V116), V120 (= V117), R126 (= R123), F127 (≠ Y124), N130 (= N127), A131 (= A128), R311 (= R311), R338 (= R338), M518 (= M511), W544 (= W537), P546 (= P539), P548 (= P541), C622 (= C615), K624 (= K617), M634 (= M627), D636 (= D629)
- binding magnesium ion: E437 (= E430), D465 (= D458)
6c2xA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-br-6-me-phenyldiketoacid (see paper)
63% identity, 99% coverage: 2:720/723 of query aligns to 2:708/711 of 6c2xA
- active site: D268 (= D270), E270 (= E272), R328 (= R338), E418 (= E430), D446 (= D458), D617 (= D629)
- binding (2S)-4-(2-bromo-6-methylphenyl)-2-hydroxy-4-oxobutanoic acid: V115 (= V116), R328 (= R338), E418 (= E430), G443 (= G455), L445 (= L457), D446 (= D458), M499 (= M511), W525 (= W537), M615 (= M627), D617 (= D629)
- binding magnesium ion: E418 (= E430), D446 (= D458)
6dkoA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2,6-f-phenyldiketoacid (see paper)
63% identity, 99% coverage: 2:720/723 of query aligns to 2:713/716 of 6dkoA
- active site: D270 (= D270), E272 (= E272), R332 (= R338), E424 (= E430), D452 (= D458), D622 (= D629)
- binding 4-(2,6-difluorophenyl)-2,4-dioxobutanoic acid: R332 (= R338), G449 (= G455), L451 (= L457), D452 (= D458), M505 (= M511), W531 (= W537), M620 (= M627), D622 (= D629)
- binding magnesium ion: E424 (= E430), D452 (= D458)
5c9wA Crystal structure of mycobacterium tuberculosis malate synthase in complex with (z)-n-(2-bromophenyl)-2-(hydroxyimino)acetamide (see paper)
62% identity, 99% coverage: 2:720/723 of query aligns to 2:710/713 of 5c9wA
- active site: D269 (= D270), E271 (= E272), R327 (= R338), E420 (= E430), D448 (= D458), D619 (= D629)
- binding (2E)-N-(2-bromophenyl)-2-(hydroxyimino)acetamide: V116 (= V116), R327 (= R338), M501 (= M511), W527 (= W537), M617 (= M627), D619 (= D629)
- binding magnesium ion: E420 (= E430), D448 (= D458), V464 (≠ I474), R465 (= R475), T468 (≠ D478)
5e9xA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-chloro-6h-thieno[2,3-b]pyrrole-5-carboxylic acid (see paper)
62% identity, 99% coverage: 2:720/723 of query aligns to 2:712/715 of 5e9xA
- active site: D267 (= D270), E269 (= E272), R327 (= R338), E422 (= E430), D450 (= D458), D621 (= D629)
- binding 2-chloranyl-6~{H}-thieno[2,3-b]pyrrole-5-carboxylic acid: V114 (= V116), S271 (= S274), M503 (= M511), M619 (= M627), E620 (= E628), D621 (= D629)
- binding magnesium ion: E422 (= E430), D450 (= D458)
6bu1A Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-br-3-oh-phenyldiketoacid (see paper)
62% identity, 99% coverage: 2:720/723 of query aligns to 1:709/712 of 6bu1A
- active site: D269 (= D270), E271 (= E272), R327 (= R338), E419 (= E430), D447 (= D458), D618 (= D629)
- binding (2Z)-4-(2-bromo-3-hydroxyphenyl)-2-hydroxy-4-oxobut-2-enoic acid: V116 (= V116), R327 (= R338), E419 (= E430), G444 (= G455), L446 (= L457), D447 (= D458), M500 (= M511), W526 (= W537), M616 (= M627), D618 (= D629)
- binding magnesium ion: E419 (= E430), D447 (= D458), V463 (≠ I474), R464 (= R475)
6dnpA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-f-3-methyl-6-f-phenyldiketoacid (see paper)
62% identity, 99% coverage: 2:720/723 of query aligns to 2:709/712 of 6dnpA
- active site: D270 (= D270), E272 (= E272), R328 (= R338), E419 (= E430), D447 (= D458), D618 (= D629)
- binding (2Z)-4-(2,6-difluoro-3-methylphenyl)-2-hydroxy-4-oxobut-2-enoic acid: R328 (= R338), E419 (= E430), G444 (= G455), L446 (= L457), D447 (= D458), M500 (= M511), W526 (= W537), M616 (= M627), D618 (= D629)
- binding magnesium ion: E419 (= E430), D447 (= D458)
5c9rA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 3-((4-chlorophenyl)thio)propanoic acid (see paper)
62% identity, 99% coverage: 2:720/723 of query aligns to 2:714/717 of 5c9rA
- active site: D270 (= D270), E272 (= E272), R331 (= R338), E424 (= E430), D452 (= D458), D623 (= D629)
- binding 3-[(4-chlorophenyl)sulfanyl]propanoic acid: V117 (= V116), E424 (= E430), D452 (= D458), M505 (= M511), W531 (= W537), M621 (= M627), D623 (= D629)
- binding magnesium ion: E424 (= E430), D452 (= D458)
5cakA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-hydroxy-3-(1h-indol-3-yl)propanoic acid (see paper)
62% identity, 99% coverage: 2:720/723 of query aligns to 2:714/717 of 5cakA
- active site: D270 (= D270), E272 (= E272), R329 (= R338), E424 (= E430), D452 (= D458), D623 (= D629)
- binding (2R)-2-hydroxy-3-(1H-indol-3-yl)propanoic acid: V117 (= V116), L451 (= L457), M505 (= M511), E622 (= E628), D623 (= D629)
- binding magnesium ion: E424 (= E430), D452 (= D458)
5drcA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-hydroxy-4-(1h-indol-3-yl)-4-oxobut-2-enoic acid (see paper)
62% identity, 99% coverage: 2:720/723 of query aligns to 2:713/716 of 5drcA
- active site: D270 (= D270), E272 (= E272), R330 (= R338), E423 (= E430), D451 (= D458), D622 (= D629)
- binding (2Z)-2-hydroxy-4-(1H-indol-3-yl)-4-oxobut-2-enoic acid: R330 (= R338), E423 (= E430), G448 (= G455), L450 (= L457), D451 (= D458), M504 (= M511), W530 (= W537), M620 (= M627), D622 (= D629)
- binding magnesium ion: E423 (= E430), D451 (= D458), R468 (= R475), T471 (≠ D478)
5cczA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 3-(4-fluorophenyl)-4-methyl-1h-pyrazol-5-amine (see paper)
62% identity, 99% coverage: 2:720/723 of query aligns to 2:710/713 of 5cczA
- active site: D267 (= D270), E269 (= E272), R325 (= R338), E420 (= E430), D448 (= D458), D619 (= D629)
- binding 3-(4-fluorophenyl)-4-methyl-1H-pyrazol-5-amine: V114 (= V116), S271 (= S274), M501 (= M511), W527 (= W537), P529 (= P539), M617 (= M627), E618 (= E628), D619 (= D629)
- binding magnesium ion: E420 (= E430), D448 (= D458)
5cbiA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 5-chloro-2-hydroxybenzonitrile (see paper)
62% identity, 99% coverage: 2:720/723 of query aligns to 2:716/719 of 5cbiA
- active site: D270 (= D270), E272 (= E272), R331 (= R338), E426 (= E430), D454 (= D458), D625 (= D629)
- binding 5-chloro-2-hydroxybenzonitrile: L53 (= L53), N54 (≠ V54), D57 (= D57), F125 (≠ Y124), Y138 (= Y137), D139 (= D138), Y142 (= Y141), M507 (= M511), W533 (= W537), P535 (= P539), A611 (≠ C615), M623 (= M627), M623 (= M627), E624 (= E628), D625 (= D629)
- binding magnesium ion: E426 (= E430), D454 (= D458)
6dl9A Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2,6-cl-phenyldiketoacid (see paper)
62% identity, 99% coverage: 2:720/723 of query aligns to 2:713/716 of 6dl9A
- active site: D270 (= D270), E272 (= E272), R328 (= R338), E423 (= E430), D451 (= D458), D622 (= D629)
- binding 4-(2,6-dichlorophenyl)-2,4-dioxobutanoic acid: V117 (= V116), R328 (= R338), E423 (= E430), G448 (= G455), L450 (= L457), D451 (= D458), M504 (= M511), W530 (= W537), M620 (= M627), D622 (= D629)
- binding magnesium ion: E423 (= E430), D451 (= D458)
5c9xA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2,4-dichloro-5-fluorobenzoic acid (see paper)
62% identity, 99% coverage: 2:720/723 of query aligns to 2:713/716 of 5c9xA
- active site: D270 (= D270), E272 (= E272), R328 (= R338), E423 (= E430), D451 (= D458), D622 (= D629)
- binding 2,4-dichloro-5-fluorobenzoic acid: V117 (= V116), S274 (= S274), R328 (= R338), M504 (= M511), W530 (= W537), M620 (= M627), D622 (= D629)
- binding magnesium ion: K295 (= K295), H363 (= H373), K366 (≠ G376), N371 (= N378), G372 (= G379), L374 (≠ R381), E423 (= E430), D451 (= D458)
5c7vA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 1h-pyrrole-2-carboxylic acid (see paper)
62% identity, 99% coverage: 2:720/723 of query aligns to 2:713/716 of 5c7vA
5cjmA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 4h-thieno[3,2-b]pyrrole-5-carboxylic acid (see paper)
62% identity, 99% coverage: 2:720/723 of query aligns to 2:708/711 of 5cjmA
- active site: D270 (= D270), E272 (= E272), R328 (= R338), E418 (= E430), D446 (= D458), D617 (= D629)
- binding 4h-thieno[3,2-b]pyrole-5-carboxylic acid: V117 (= V116), S274 (= S274), M499 (= M511), E616 (= E628), D617 (= D629)
- binding magnesium ion: E418 (= E430), D446 (= D458)
Query Sequence
>SMc02581 FitnessBrowser__Smeli:SMc02581
MDRVEKYGLQIDAGLHRFLVEEAMPGTGVDADRFFSAFSDLVHDLGPKNRALLVKRDELQ
ARLDGWYREHGAPVDMEAYEAFLREIGYLLPEGPDFYVSTANVDSEIATIAGPQLVVPVM
NARYALNAANARWGSLYDALYGTDAIAETDGAERGKGYNPKRGAKVIAWAREFLDASAPL
AAGRWSDAKSFSVEGATLTVTLADGTKSAPRNSVQFAGYAGDPAAPSEIVLRRNGLHIVI
VLDATTPIGKADAAGISDVVLESAITTIMDCEDSIAAVDAEDKVLVYRNWLGLMKGDLEE
EVTKGGRAFTRRLNPDRAYTAPDGATLTLPGRSLMLVRNVGHLMTNPAVLDRDGEEVPEG
LMDAMVTALIALHDIGRNGRRANSRSGSMYVVKPKMHGPEEVAFACEIFARVEAALGLPA
NAMKMGIMDEERRTTVNLKECIRAARERVVFINTGFLDRTGDEIHTSMEAGPMIRKGDMK
QAPWISAYENWNVDVGLECGLSGHAQIGKGMWAMPDLMAAMLEQKIVHPKAGANTAWVPS
PTAATLHATHYHRVNVAEVQASLKSRTRAKLADILSVPVAARPNWTEEEIQRELDNNAQG
ILGYVVRWVDQGVGCSKVPDINNVGLMEDRATLRISAQHMANWLHHGIVSEAQIVETMQR
MAAIVDGQNAGDPNYQPMAGRFEESIAFQAALDLVLKGREQPNGYTEPVLHRRRLELKAK
QGA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory