Comparing SMc02595 FitnessBrowser__Smeli:SMc02595 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1cs1D Cystathionine gamma-synthase (cgs) from escherichia coli (see paper)
53% identity, 93% coverage: 30:407/408 of query aligns to 2:380/384 of 1cs1D
P00935 Cystathionine gamma-synthase; CGS; O-succinylhomoserine (thiol)-lyase; EC 2.5.1.48 from Escherichia coli (strain K12) (see paper)
53% identity, 93% coverage: 30:407/408 of query aligns to 4:382/386 of P00935
6ld9A Crystal structure of cystathionine gamma synthase from xanthomonas oryzae pv. Oryzae in complex with cystathionine
55% identity, 92% coverage: 31:405/408 of query aligns to 5:380/387 of 6ld9A
6ld8A Crystal structure of cystathionine gamma synthase from xanthomonas oryzae pv. Oryzae in complex with aminoacrylate and cysteine
54% identity, 92% coverage: 31:405/408 of query aligns to 5:380/388 of 6ld8A
6lgoA Crystal structure of cystathionine gamma synthase from xanthomonas oryzae pv. Oryzae in complex with homolanthionine
54% identity, 92% coverage: 31:405/408 of query aligns to 5:380/387 of 6lgoA
4iyoB Crystal structure of cystathionine gamma lyase from xanthomonas oryzae pv. Oryzae (xometc) in complex with e-site serine, a-site serine, a- site external aldimine structure with aminoacrylate and a-site iminopropionate intermediates (see paper)
44% identity, 91% coverage: 33:405/408 of query aligns to 6:380/381 of 4iyoB
4iy7B Crystal structure of cystathionine gamma lyase (xometc) from xanthomonas oryzae pv. Oryzae in complex with e-site serine, a-site external aldimine structure with serine and a-site external aldimine structure with aminoacrylate intermediates (see paper)
44% identity, 91% coverage: 33:405/408 of query aligns to 6:380/381 of 4iy7B
4iy7A Crystal structure of cystathionine gamma lyase (xometc) from xanthomonas oryzae pv. Oryzae in complex with e-site serine, a-site external aldimine structure with serine and a-site external aldimine structure with aminoacrylate intermediates (see paper)
44% identity, 91% coverage: 33:405/408 of query aligns to 6:380/381 of 4iy7A
4ixzA Native structure of cystathionine gamma lyase (xometc) from xanthomonas oryzae pv. Oryzae at ph 9.0 (see paper)
44% identity, 91% coverage: 33:405/408 of query aligns to 6:380/381 of 4ixzA
4iyoD Crystal structure of cystathionine gamma lyase from xanthomonas oryzae pv. Oryzae (xometc) in complex with e-site serine, a-site serine, a- site external aldimine structure with aminoacrylate and a-site iminopropionate intermediates (see paper)
44% identity, 91% coverage: 33:405/408 of query aligns to 6:380/384 of 4iyoD
7ba4A Structure of cystathionine gamma-lyase from pseudomonas aeruginosa
45% identity, 90% coverage: 39:405/408 of query aligns to 15:371/377 of 7ba4A
4l0oH Structure determination of cystathionine gamma-synthase from helicobacter pylori
42% identity, 91% coverage: 30:402/408 of query aligns to 2:367/373 of 4l0oH
7d7oB Crystal structure of cystathionine gamma-lyase from bacillus cereus atcc 14579 (see paper)
41% identity, 90% coverage: 34:401/408 of query aligns to 5:372/377 of 7d7oB
4ixsB Native structure of xometc at ph 5.2 (see paper)
44% identity, 91% coverage: 33:405/408 of query aligns to 5:371/372 of 4ixsB
6k1lB E53a mutant of a putative cystathionine gamma-lyase (see paper)
44% identity, 89% coverage: 33:397/408 of query aligns to 7:373/382 of 6k1lB
6k1lA E53a mutant of a putative cystathionine gamma-lyase (see paper)
44% identity, 89% coverage: 33:397/408 of query aligns to 7:373/382 of 6k1lA
6le4A Crystal structure of cystathionine gamma-lyase from lactobacillus plantarum complexed with cystathionine (see paper)
39% identity, 93% coverage: 30:408/408 of query aligns to 2:378/380 of 6le4A
6ldoA Crystal structure of cystathionine gamma-lyase from lactobacillus plantarum complexed with l-serine (see paper)
39% identity, 93% coverage: 30:408/408 of query aligns to 2:378/381 of 6ldoA
3qhxA Crystal structure of cystathionine gamma-synthase metb (cgs) from mycobacterium ulcerans agy99 bound to hepes (see paper)
43% identity, 92% coverage: 33:406/408 of query aligns to 5:377/377 of 3qhxA
6cjaA Crystal structure of cystathionine beta-lyase from legionella pneumophila philadelphia 1 in complex with alanyl-plp and serine
41% identity, 88% coverage: 47:406/408 of query aligns to 20:381/381 of 6cjaA
>SMc02595 FitnessBrowser__Smeli:SMc02595
MPRLIPTSHADLMPSRDLLPMLERKSRSDRAETTAAAHGVATDPAFGSVVPPLYLSSTYE
FAGFDTPRAYDYGRSGNPTRDLLAQALAKLEGGADAVVTPSGMAALDLLLGRLRRNHLVL
APHDCYGGTLRLLKARADLGHLTFRLTDQRDFGGFEAALSDAPALVLIESPSNPLMRVTD
IARLSTLAKAAGSAVAVDNTFLSPALQQPLSLGADYAIHSATKFLNGHSDVIAGAVIAAE
PQEAHDLKRWANVTGAVAAPFDAWLTLRGLRTLFARMSSQERSAMTIAEYLDAHPAVRHV
HYAGLPDHADHEVARRQQRGFGAMMSFELEGGVPAVRRFLAHIRCFTLAESLGGVESLVA
HPATMTHLDMGPEARERAGIRDELLRLSIGLEHIDDLMEGLELGLGAC
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory