Comparing SMc02648 FitnessBrowser__Smeli:SMc02648 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q92R43 Aquaglyceroporin AqpS from Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
100% identity, 100% coverage: 1:233/233 of query aligns to 1:233/233 of Q92R43
P08995 Nodulin-26; N-26 from Glycine max (Soybean) (Glycine hispida) (see paper)
35% identity, 44% coverage: 8:109/233 of query aligns to 38:137/271 of P08995
Sites not aligning to the query:
3nkaA Crystal structure of aqpz h174g,t183f (see paper)
33% identity, 45% coverage: 5:108/233 of query aligns to 2:104/230 of 3nkaA
Sites not aligning to the query:
2o9eA Crystal structure of aqpz mutant t183c complexed with mercury (see paper)
33% identity, 44% coverage: 6:108/233 of query aligns to 3:104/232 of 2o9eA
Sites not aligning to the query:
P60844 Aquaporin Z; Bacterial nodulin-like intrinsic protein; Water channel AqpZ from Escherichia coli (strain K12) (see paper)
33% identity, 44% coverage: 6:108/233 of query aligns to 1:102/231 of P60844
Sites not aligning to the query:
B1VB61 Propanediol uptake facilitator PduF from Citrobacter freundii (see paper)
35% identity, 45% coverage: 5:109/233 of query aligns to 4:106/269 of B1VB61
Sites not aligning to the query:
P37451 Propanediol uptake facilitator PduF from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
33% identity, 45% coverage: 5:110/233 of query aligns to 4:107/264 of P37451
Sites not aligning to the query:
I1CR68 Aquaporin-1 from Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) (Mucormycosis agent) (Rhizopus arrhizus var. delemar) (see paper)
30% identity, 44% coverage: 8:110/233 of query aligns to 59:160/306 of I1CR68
Sites not aligning to the query:
P0AER0 Glycerol uptake facilitator protein; Aquaglyceroporin; Glycerol facilitator from Escherichia coli (strain K12) (see 3 papers)
31% identity, 47% coverage: 2:111/233 of query aligns to 3:115/281 of P0AER0
Sites not aligning to the query:
1fx8A Crystal structure of the e. Coli glycerol facilitator (glpf) with substrate glycerol (see paper)
32% identity, 45% coverage: 6:111/233 of query aligns to 2:110/254 of 1fx8A
Sites not aligning to the query:
Q6Z2T3 Aquaporin NIP2-1; Low silicon protein 1; NOD26-like intrinsic protein 2-1; OsNIP2;1; Silicon influx transporter LSI1 from Oryza sativa subsp. japonica (Rice) (see paper)
30% identity, 79% coverage: 6:190/233 of query aligns to 47:236/298 of Q6Z2T3
Q41951 Aquaporin TIP2-1; Delta-tonoplast intrinsic protein; Delta-TIP; Tonoplast intrinsic protein 2-1; AtTIP2;1 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
42% identity, 40% coverage: 8:100/233 of query aligns to 19:114/250 of Q41951
Sites not aligning to the query:
8ct2D Local refinement of aqp1 tetramer (c1; refinement mask included d1 of protein 4.2 and ankyrin-1 ar1-5) in class 2 of erythrocyte ankyrin-1 complex (see paper)
36% identity, 42% coverage: 8:104/233 of query aligns to 10:109/247 of 8ct2D
Sites not aligning to the query:
Q96PS8 Aquaporin-10; AQP-10; Aquaglyceroporin-10; Small intestine aquaporin from Homo sapiens (Human) (see 2 papers)
28% identity, 45% coverage: 6:110/233 of query aligns to 20:123/301 of Q96PS8
Sites not aligning to the query:
6f7hC Crystal structure of human aqp10 (see paper)
28% identity, 45% coverage: 6:110/233 of query aligns to 5:108/253 of 6f7hC
Sites not aligning to the query:
P41181 Aquaporin-2; AQP-2; ADH water channel; Aquaporin-CD; AQP-CD; Collecting duct water channel protein; WCH-CD; Water channel protein for renal collecting duct from Homo sapiens (Human) (see 12 papers)
36% identity, 50% coverage: 1:116/233 of query aligns to 4:112/271 of P41181
Sites not aligning to the query:
4nefA X-ray structure of human aquaporin 2 (see paper)
35% identity, 50% coverage: 1:116/233 of query aligns to 3:111/239 of 4nefA
P06624 Lens fiber major intrinsic protein; Aquaporin-0; MIP26; MP26 from Bos taurus (Bovine) (see 4 papers)
34% identity, 34% coverage: 28:106/233 of query aligns to 27:105/263 of P06624
Sites not aligning to the query:
P25818 Aquaporin TIP1-1; Aquaporin TIP; Gamma-tonoplast intrinsic protein; Gamma-TIP; Tonoplast intrinsic protein 1-1; AtTIP1;1; Tonoplast intrinsic protein, root-specific RB7 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
29% identity, 76% coverage: 5:180/233 of query aligns to 18:205/251 of P25818
P56402 Aquaporin-2; AQP-2; ADH water channel; Aquaporin-CD; AQP-CD; Collecting duct water channel protein; WCH-CD; Water channel protein for renal collecting duct from Mus musculus (Mouse) (see 2 papers)
31% identity, 50% coverage: 1:116/233 of query aligns to 4:112/271 of P56402
Sites not aligning to the query:
>SMc02648 FitnessBrowser__Smeli:SMc02648
MQEFDLTRRCVAEALGTGLLVAAVVGSGIMADALTADDALALVANTIATGAILVVLVTIL
GPLSGAHFNPAVSLVFALSGRLTRRDCAAYVIAQVAGAIAGTALAHLMFDLPPLDMSMKV
RTGPAQWLSEGVAAFGLVATILAGIRFHREAVPWLVGLYITAAYWFTASTSFANPAVALA
RSFTNTFSGIRPGDLPGFVIAELLGAVCALALMRWLLQPARPIIRQTSPETAP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory