SitesBLAST
Comparing SMc02766 FitnessBrowser__Smeli:SMc02766 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5ey5B Lbcats
71% identity, 94% coverage: 18:400/406 of query aligns to 1:383/383 of 5ey5B
- binding pyridoxal-5'-phosphate: H81 (= H98), K82 (= K99), Q109 (= Q126), S185 (≠ T202), G227 (= G244), G229 (= G246), S230 (= S247), N231 (= N248), E345 (= E362), S371 (= S388), G372 (= G389)
5ocwB Structure of mycobacterium tuberculosis tryptophan synthase in space group f222 (see paper)
61% identity, 96% coverage: 14:404/406 of query aligns to 5:398/399 of 5ocwB
- active site: K93 (= K99), E115 (= E121), S382 (= S388)
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: H92 (= H98), K93 (= K99), T116 (= T122), G117 (= G123), A118 (= A124), Q120 (= Q126), H121 (= H127), T196 (= T202), G238 (= G244), G240 (= G246), S241 (= S247), N242 (= N248), G309 (= G315), E356 (= E362), S382 (= S388)
6u6cB Crystal structure of tryptophan synthase from m. Tuberculosis - aminoacrylate- and gsk2-bound form (see paper)
61% identity, 96% coverage: 14:404/406 of query aligns to 10:403/405 of 6u6cB
- active site: K98 (= K99), E120 (= E121), S387 (= S388)
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: H97 (= H98), K98 (= K99), T121 (= T122), G122 (= G123), A123 (= A124), Q125 (= Q126), H126 (= H127), T201 (= T202), G243 (= G244), G245 (= G246), S246 (= S247), N247 (= N248), G314 (= G315), E361 (= E362), S387 (= S388)
- binding 1-(2-fluorobenzene-1-carbonyl)-N-methyl-2,3-dihydro-1H-indole-5-sulfonamide: Y26 (≠ F27), F185 (≠ L186), W188 (= W189), Y197 (= Y198), F199 (≠ I200), G204 (= G205), P205 (= P206), H291 (= H292), G292 (= G293)
6usaB Crystal structure of tryptophan synthase from m. Tuberculosis - aminoacrylate- and gsk1-bound form (see paper)
61% identity, 96% coverage: 14:404/406 of query aligns to 9:402/404 of 6usaB
- active site: K97 (= K99), E119 (= E121), S386 (= S388)
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: H96 (= H98), K97 (= K99), T120 (= T122), G121 (= G123), A122 (= A124), G123 (= G125), Q124 (= Q126), H125 (= H127), T200 (= T202), G242 (= G244), G244 (= G246), S245 (= S247), N246 (= N248), G313 (= G315), E360 (= E362), S386 (= S388)
- binding (3R,4R)-4-[4-(2-Chlorophenyl)piperazin-1-yl]-1,1-dioxothiolan-3-ol: F184 (≠ L186), W187 (= W189), Y196 (= Y198), F198 (≠ I200), G203 (= G205), P204 (= P206), F207 (≠ Y209), H290 (= H292), G291 (= G293)
6dweB Crystal structure of tryptophan synthase from m. Tuberculosis - aminoacrylate- and brd0059-bound form
61% identity, 96% coverage: 14:404/406 of query aligns to 9:402/404 of 6dweB
- active site: K97 (= K99), E119 (= E121), S386 (= S388)
- binding (2R,3S,4R)-3-(2',6'-difluoro-4'-methyl[1,1'-biphenyl]-4-yl)-4-(fluoromethyl)azetidine-2-carbonitrile: F184 (≠ L186), Y196 (= Y198), F198 (≠ I200), P204 (= P206), F207 (≠ Y209), H290 (= H292)
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: H96 (= H98), K97 (= K99), T120 (= T122), G121 (= G123), A122 (= A124), G123 (= G125), Q124 (= Q126), H125 (= H127), T200 (= T202), G242 (= G244), G244 (= G246), S245 (= S247), N246 (= N248), G313 (= G315), E360 (= E362), S386 (= S388)
5tciH Crystal structure of tryptophan synthase from m. Tuberculosis - brd4592-bound form (see paper)
61% identity, 96% coverage: 14:404/406 of query aligns to 10:403/406 of 5tciH
- active site: K98 (= K99), E120 (= E121), S387 (= S388)
- binding (2R,3S,4R)-3-(2'-fluoro[1,1'-biphenyl]-4-yl)-4-(hydroxymethyl)azetidine-2-carbonitrile: P28 (≠ A29), L31 (= L32), Y197 (= Y198), F199 (≠ I200), P205 (= P206), F208 (≠ Y209), H291 (= H292)
6uapB Crystal structure of tryptophan synthase from m. Tuberculosis - open form with brd6309 bound
61% identity, 96% coverage: 14:404/406 of query aligns to 9:402/405 of 6uapB
- active site: K97 (= K99), E119 (= E121), S386 (= S388)
- binding (2R,3S,4R)-3-(4'-chloro-2',6'-difluoro[1,1'-biphenyl]-4-yl)-4-(fluoromethyl)azetidine-2-carbonitrile: I180 (≠ M182), N181 (= N183), F184 (≠ L186), Y196 (= Y198), F198 (≠ I200), P204 (= P206), F207 (≠ Y209), H290 (= H292)
5t6mB Structure of the tryptophan synthase b-subunit from pyroccus furiosus with b-methyltryptophan non-covalently bound (see paper)
62% identity, 95% coverage: 20:403/406 of query aligns to 3:386/386 of 5t6mB
1v8zA X-ray crystal structure of the tryptophan synthase b2 subunit from hyperthermophile, pyrococcus furiosus (see paper)
62% identity, 95% coverage: 20:403/406 of query aligns to 3:386/386 of 1v8zA
- active site: K82 (= K99), E104 (= E121), S371 (= S388)
- binding pyridoxal-5'-phosphate: H81 (= H98), K82 (= K99), Q109 (= Q126), S185 (≠ T202), G227 (= G244), G228 (= G245), G229 (= G246), S230 (= S247), N231 (= N248), E345 (= E362), S371 (= S388), G372 (= G389)
5dw0A Trpb from pyrococcus furiosus with l-serine bound as the external aldimine (see paper)
62% identity, 95% coverage: 20:403/406 of query aligns to 3:386/388 of 5dw0A
- active site: K82 (= K99), E104 (= E121), S371 (= S388)
- binding [3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-serine: H81 (= H98), K82 (= K99), T105 (= T122), G106 (= G123), A107 (= A124), Q109 (= Q126), H110 (= H127), S185 (≠ T202), G227 (= G244), G229 (= G246), S230 (= S247), N231 (= N248), G298 (= G315), D300 (= D317), E345 (= E362), S371 (= S388)
6am8B Engineered tryptophan synthase b-subunit from pyrococcus furiosus, pftrpb2b9 with trp bound as e(aex2) (see paper)
62% identity, 94% coverage: 20:400/406 of query aligns to 3:383/385 of 6am8B
- active site: K82 (= K99), E104 (= E121), S371 (= S388)
- binding [3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-l-tryptophane: H81 (= H98), K82 (= K99), E104 (= E121), T105 (= T122), G106 (= G123), A107 (= A124), Q109 (= Q126), H110 (= H127), L161 (= L178), S185 (≠ T202), V187 (≠ A204), G227 (= G244), G228 (= G245), G229 (= G246), S230 (= S247), N231 (= N248), G298 (= G315), Y301 (= Y318), E345 (= E362), S371 (= S388), G372 (= G389)
- binding tryptophan: P12 (≠ A29), L169 (= L186), S274 (≠ L291), H275 (= H292)
5dw3A Tryptophan synthase beta-subunit from pyrococcus furiosus with product l-tryptophan non-covalently bound in the active site (see paper)
62% identity, 94% coverage: 20:401/406 of query aligns to 3:383/383 of 5dw3A
- active site: K82 (= K99), E104 (= E121), S370 (= S388)
- binding tryptophan: K82 (= K99), E104 (= E121), T105 (= T122), G106 (= G123), A107 (= A124), Q109 (= Q126), H110 (= H127), S185 (≠ T202), G228 (= G245), Y300 (= Y318)
5ixjD Tryptophan synthase beta-subunit from pyrococcus furiosus with l- threonine non-covalently bound in the active site (see paper)
62% identity, 95% coverage: 20:403/406 of query aligns to 3:384/394 of 5ixjD
5t6mA Structure of the tryptophan synthase b-subunit from pyroccus furiosus with b-methyltryptophan non-covalently bound (see paper)
62% identity, 94% coverage: 20:401/406 of query aligns to 3:382/383 of 5t6mA
7rnpA Engineered tryptophan synthase b-subunit from pyrococcus furiosus, pftrpb2b9_h275e with 4-cl-trp non-covalently bound (see paper)
61% identity, 94% coverage: 20:400/406 of query aligns to 3:383/384 of 7rnpA
5vm5D Engineered tryptophan synthase b-subunit from pyrococcus furiosus, pftrpb2b9, with ser bound (see paper)
62% identity, 94% coverage: 20:400/406 of query aligns to 3:381/383 of 5vm5D
- active site: K82 (= K99), E104 (= E121), S369 (= S388)
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: H81 (= H98), K82 (= K99), T105 (= T122), G106 (= G123), A107 (= A124), Q109 (= Q126), H110 (= H127), S185 (≠ T202), G227 (= G244), G229 (= G246), S230 (= S247), N231 (= N248), G296 (= G315), E343 (= E362), S369 (= S388)
6cutA Engineered holo trpb from pyrococcus furiosus, pftrpb7e6 with (2s,3s)- isopropylserine bound as the external aldimine (see paper)
61% identity, 94% coverage: 20:400/406 of query aligns to 3:383/385 of 6cutA
- binding (2S,3S)-3-hydroxy-2-[(E)-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)amino]-4-methylpentanoic acid (non-preferred name): H81 (= H98), K82 (= K99), T105 (= T122), G106 (= G123), A107 (= A124), Q109 (= Q126), H110 (= H127), S185 (≠ T202), G227 (= G244), G229 (= G246), S230 (= S247), N231 (= N248), G298 (= G315), E345 (= E362), S371 (= S388)
6cuzA Engineered trpb from pyrococcus furiosus, pftrpb7e6 with (2s,3r)- ethylserine bound as the amino-acrylate (see paper)
61% identity, 94% coverage: 20:400/406 of query aligns to 3:383/383 of 6cuzA
- binding (2E)-2-[(E)-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)amino]pent-2-enoic acid: H81 (= H98), K82 (= K99), T105 (= T122), G106 (= G123), A107 (= A124), Q109 (= Q126), H110 (= H127), S185 (≠ T202), G227 (= G244), G229 (= G246), S230 (= S247), N231 (= N248), G298 (= G315), E345 (= E362), S371 (= S388)
2clfB Tryptophan synthase in complex with n-(4'- trifluoromethoxybenzoyl)-2-amino-1-ethylphosphate (f6) - highf6 complex (see paper)
58% identity, 94% coverage: 20:402/406 of query aligns to 8:390/394 of 2clfB
- active site: K86 (= K99), E108 (= E121), S376 (= S388)
- binding 2-{[4-(trifluoromethoxy)benzoyl]amino}ethyl dihydrogen phosphate: P17 (≠ A29), E108 (= E121), T109 (= T122), G110 (= G123), H114 (= H127), L165 (= L178), C169 (≠ M182), L187 (≠ I200), G188 (= G201), T189 (= T202), F279 (≠ H292)
- binding pyridoxal-5'-phosphate: H85 (= H98), K86 (= K99), T189 (= T202), G231 (= G244), G232 (= G245), G233 (= G246), S234 (= S247), N235 (= N248), E349 (= E362), S376 (= S388), G377 (= G389)
Sites not aligning to the query:
1a50B Crystal structure of wild-type tryptophan synthase complexed with 5- fluoroindole propanol phosphate (see paper)
58% identity, 94% coverage: 20:402/406 of query aligns to 8:390/390 of 1a50B
- active site: K86 (= K99), E108 (= E121), T109 (= T122), T189 (= T202), G231 (= G244), G232 (= G245), G233 (= G246), S234 (= S247), N235 (= N248), S350 (≠ P363), S376 (= S388)
- binding pyridoxal-5'-phosphate: H85 (= H98), K86 (= K99), T189 (= T202), G231 (= G244), G232 (= G245), G233 (= G246), S234 (= S247), N235 (= N248), E349 (= E362), S376 (= S388), G377 (= G389)
Query Sequence
>SMc02766 FitnessBrowser__Smeli:SMc02766
MNQPPKPNSFRSGPDEEGRFGIFGGRFVAETLMPLILDLQDEWARAKNDPAFKAELENLG
THYIGRPSPLYFAERLTAELGGAKIYFKREELNHTGSHKINNCIGQILLAKRMGKTRIIA
ETGAGQHGVASATVAARFGLPCVVYMGATDVERQAPNVFRMKLLGAEVKPVTAGNGTLKD
AMNEALRDWVTNVDSTYYLIGTAAGPHPYPEMVRDFQAVIGEEAKQQILEAEGRLPDLVV
AAVGGGSNAIGIFHSFLDDEGVRIVGVEAGGKGLDGDEHCASLTAGSPGVLHGNRTYLLQ
DGDGQIKEGHSISAGLDYPGIGPEHAWLNDIGRVEYVPIMDHEALEAFQTLTRLEGIIPA
LEPSHALAEVIKRAPKMGKDEIILMNLSGRGDKDIFTVGKILGMGQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory