Comparing SMc02791 FitnessBrowser__Smeli:SMc02791 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2hk9B Crystal structure of shikimate dehydrogenase from aquifex aeolicus in complex with shikimate and NADP+ at 2.2 angstrom resolution (see paper)
37% identity, 88% coverage: 14:265/286 of query aligns to 11:252/267 of 2hk9B
2hk9A Crystal structure of shikimate dehydrogenase from aquifex aeolicus in complex with shikimate and NADP+ at 2.2 angstrom resolution (see paper)
37% identity, 88% coverage: 14:265/286 of query aligns to 11:252/269 of 2hk9A
Q5HNV1 Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 from Staphylococcus epidermidis (strain ATCC 35984 / RP62A) (see paper)
35% identity, 94% coverage: 14:282/286 of query aligns to 5:265/269 of Q5HNV1
O67049 Shikimate dehydrogenase (NADP(+)); SD; SDH; EC 1.1.1.25 from Aquifex aeolicus (strain VF5) (see paper)
37% identity, 88% coverage: 14:265/286 of query aligns to 11:252/269 of O67049
3dooA Crystal structure of shikimate dehydrogenase from staphylococcus epidermidis complexed with shikimate (see paper)
34% identity, 94% coverage: 14:282/286 of query aligns to 5:256/258 of 3dooA
Q9KVT3 Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
35% identity, 94% coverage: 9:277/286 of query aligns to 5:270/278 of Q9KVT3
3pgjA 2.49 angstrom resolution crystal structure of shikimate 5- dehydrogenase (aroe) from vibrio cholerae o1 biovar eltor str. N16961 in complex with shikimate
35% identity, 94% coverage: 9:277/286 of query aligns to 1:266/272 of 3pgjA
P15770 Shikimate dehydrogenase (NADP(+)); SD; SDH; EC 1.1.1.25 from Escherichia coli (strain K12) (see paper)
37% identity, 92% coverage: 14:277/286 of query aligns to 6:266/272 of P15770
1nytA Shikimate dehydrogenase aroe complexed with NADP+ (see paper)
37% identity, 92% coverage: 14:277/286 of query aligns to 6:266/271 of 1nytA
2ev9B Crystal structure of shikimate 5-dehydrogenase (aroe) from thermus thermophilus hb8 in complex with NADP(h) and shikimate (see paper)
38% identity, 89% coverage: 14:268/286 of query aligns to 6:248/263 of 2ev9B
Q5SJF8 Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
38% identity, 89% coverage: 14:268/286 of query aligns to 6:248/263 of Q5SJF8
2cy0A Crystal structure of shikimate 5-dehydrogenase (aroe) from thermus thermophilus hb8 in complex with NADP (see paper)
38% identity, 89% coverage: 14:268/286 of query aligns to 6:248/262 of 2cy0A
1npdB X-ray structure of shikimate dehydrogenase complexed with NAD+ from e.Coli (ydib) northeast structural genomics research consortium (nesg) target er24 (see paper)
32% identity, 88% coverage: 14:265/286 of query aligns to 12:272/288 of 1npdB
P0A6D5 Quinate/shikimate dehydrogenase; NAD-dependent shikimate 5-dehydrogenase; EC 1.1.1.282 from Escherichia coli (strain K12) (see 4 papers)
32% identity, 88% coverage: 14:265/286 of query aligns to 12:272/288 of P0A6D5
Sites not aligning to the query:
1o9bA Quinate/shikimate dehydrogenase ydib complexed with nadh (see paper)
32% identity, 88% coverage: 14:265/286 of query aligns to 6:266/280 of 1o9bA
3sefA 2.4 angstrom resolution crystal structure of shikimate 5-dehydrogenase (aroe) from vibrio cholerae o1 biovar eltor str. N16961 in complex with shikimate and NADPH
35% identity, 94% coverage: 9:277/286 of query aligns to 1:262/268 of 3sefA
Q58484 Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
30% identity, 95% coverage: 14:284/286 of query aligns to 11:282/282 of Q58484
1nvtB Crystal structure of shikimate dehydrogenase (aroe or mj1084) in complex with NADP+ (see paper)
30% identity, 95% coverage: 14:284/286 of query aligns to 16:287/287 of 1nvtB
1nvtA Crystal structure of shikimate dehydrogenase (aroe or mj1084) in complex with NADP+ (see paper)
30% identity, 95% coverage: 14:284/286 of query aligns to 16:287/287 of 1nvtA
3sefC 2.4 angstrom resolution crystal structure of shikimate 5-dehydrogenase (aroe) from vibrio cholerae o1 biovar eltor str. N16961 in complex with shikimate and NADPH
32% identity, 94% coverage: 9:277/286 of query aligns to 1:239/244 of 3sefC
>SMc02791 FitnessBrowser__Smeli:SMc02791
MHDSRETFVNHAFVTGYPVKHSRSPLIHGHWLKQFGIRGSYRAHEVTPEAFPDFMRQIKE
GRTDFCGGNVTIPHKEAAFRLADRPDELSAELGAANTLWLENGKIRATNTDGRGFVANLD
ERAKGWDRISAAVILGAGGASRAVIQAIRDRGVKTIHVVNRTPERARELADRFGTAVHAH
SMAALPEVVSGAGLFVNTTSLGMDGEPAPAIDFSGLAPDAVVTDIVYVPLKTPLLRQAEE
QGFRIVDGLGMLLHQAVPGFEKWFGLRPVVDETLRQIIISDMDRHA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory