Comparing SMc02838 FitnessBrowser__Smeli:SMc02838 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P36623 Phosphoglycerate mutase; PGAM; BPG-dependent PGAM; MPGM; Phosphoglyceromutase; EC 5.4.2.11 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
65% identity, 95% coverage: 5:204/211 of query aligns to 10:209/211 of P36623
P18669 Phosphoglycerate mutase 1; BPG-dependent PGAM 1; Phosphoglycerate mutase isozyme B; PGAM-B; EC 5.4.2.11; EC 5.4.2.4 from Homo sapiens (Human) (see 4 papers)
49% identity, 96% coverage: 5:206/211 of query aligns to 6:235/254 of P18669
Sites not aligning to the query:
7xb8B Phosphoglycerate mutase 1 complexed with a covalent inhibitor
49% identity, 96% coverage: 5:206/211 of query aligns to 4:233/249 of 7xb8B
7xb7B Phosphoglycerate mutase 1 complexed with a covalent inhibitor
49% identity, 96% coverage: 5:206/211 of query aligns to 4:233/246 of 7xb7B
8itcC Phosphoglycerate mutase 1 complexed with a compound
49% identity, 96% coverage: 5:206/211 of query aligns to 5:234/237 of 8itcC
8itbC Phosphoglycerate mutase 1 complexed with a compound
49% identity, 96% coverage: 5:206/211 of query aligns to 5:234/237 of 8itbC
8it7C Phosphoglycerate mutase 1 complexed with a compound
49% identity, 96% coverage: 5:206/211 of query aligns to 5:234/237 of 8it7C
8it6C Phosphoglycerate mutase 1 complexed with a compound
49% identity, 96% coverage: 5:206/211 of query aligns to 5:234/237 of 8it6C
8it5C Phosphoglycerate mutase 1 complexed with a compound
49% identity, 96% coverage: 5:206/211 of query aligns to 5:234/237 of 8it5C
5y35C Phosphoglycerate mutase 1 complexed with a small molecule inhibitor kh1
49% identity, 96% coverage: 5:206/211 of query aligns to 5:234/237 of 5y35C
8itdC Phosphoglycerate mutase 1 complexed with a compound
49% identity, 96% coverage: 5:206/211 of query aligns to 5:234/242 of 8itdC
5y2uB X-ray structure of phosphoglycerate mutase 1(pgam1) complexed with a small molecule
49% identity, 96% coverage: 5:206/211 of query aligns to 4:233/237 of 5y2uB
1yfkA Crystal structure of human b type phosphoglycerate mutase (see paper)
49% identity, 96% coverage: 5:206/211 of query aligns to 4:233/243 of 1yfkA
5y65C Phosphoglycerate mutase 1 complexed with a small molecule inhibitor kh2
49% identity, 96% coverage: 5:206/211 of query aligns to 4:233/239 of 5y65C
8it8C Phosphoglycerate mutase 1 complexed with a compound
49% identity, 96% coverage: 5:206/211 of query aligns to 5:234/240 of 8it8C
5zs8C Acetylation of lysine 100 of phosphoglycerate mutase 1 complexed with kh_ol
49% identity, 96% coverage: 5:206/211 of query aligns to 5:234/240 of 5zs8C
6isnC Phosphoglycerate mutase 1 complexed with a small molecule inhibitor
49% identity, 96% coverage: 5:206/211 of query aligns to 5:234/234 of 6isnC
5zrmC Phosphoglycerate mutase 1 complexed with a small molecule inhibitor in-ac
49% identity, 96% coverage: 5:206/211 of query aligns to 5:234/234 of 5zrmC
8it4A Phosphoglycerate mutase 1 complexed with a covalent inhibitor
49% identity, 96% coverage: 5:206/211 of query aligns to 4:233/233 of 8it4A
5y2iB Phosphoglycerate mutase 1 (pgam1) complexed with its inhibitor pgmi- 004a
49% identity, 96% coverage: 5:206/211 of query aligns to 4:233/233 of 5y2iB
>SMc02838 FitnessBrowser__Smeli:SMc02838
MSGTLVLVRHGQSDWNLKNLFTGWRDPDLTELGIEEAKAGGKALADYGIKFDIAFTSVLI
RAQRTCQLVLDAVGQSSLETIRDQALNERDYGDLSGLNKDDARAKWGEEQVHIWRRSYDV
PPPGGESLRDTGARVWPYYLTDILPRVLSGEKVLVAAHGNSLRSLVMVLDKLTKEQILKL
NLATGVPMVYKLNADSTVASKEVLGDMSGAH
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory