Comparing SMc02852 FitnessBrowser__Smeli:SMc02852 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 19 hits to proteins with known functional sites (download)
4g1pA Structural and mechanistic basis of substrate recognition by novel di- peptidase dug1p from saccharomyces cerevisiae
29% identity, 99% coverage: 1:458/464 of query aligns to 1:471/479 of 4g1pA
4mmoA The crystal structure of a m20 family metallo-carboxypeptidase sso-cp2 from sulfolobus solfataricus
32% identity, 86% coverage: 56:452/464 of query aligns to 39:425/437 of 4mmoA
2zogA Crystal structure of mouse carnosinase cn2 complexed with zn and bestatin (see paper)
26% identity, 97% coverage: 2:452/464 of query aligns to 5:465/478 of 2zogA
2zofA Crystal structure of mouse carnosinase cn2 complexed with mn and bestatin (see paper)
26% identity, 97% coverage: 2:452/464 of query aligns to 5:465/478 of 2zofA
Q9D1A2 Cytosolic non-specific dipeptidase; CNDP dipeptidase 2; Glutamate carboxypeptidase-like protein 1; Threonyl dipeptidase; EC 3.4.13.18 from Mus musculus (Mouse) (see 2 papers)
26% identity, 97% coverage: 2:452/464 of query aligns to 1:461/475 of Q9D1A2
Q96KP4 Cytosolic non-specific dipeptidase; CNDP dipeptidase 2; Glutamate carboxypeptidase-like protein 1; Peptidase A; Threonyl dipeptidase; EC 3.4.13.18 from Homo sapiens (Human)
26% identity, 97% coverage: 2:452/464 of query aligns to 1:461/475 of Q96KP4
2pokA Crystal structure of a m20 family metallo peptidase from streptococcus pneumoniae
33% identity, 72% coverage: 21:352/464 of query aligns to 21:350/458 of 2pokA
Sites not aligning to the query:
Q96KN2 Beta-Ala-His dipeptidase; CNDP dipeptidase 1; Carnosine dipeptidase 1; Glutamate carboxypeptidase-like protein 2; Serum carnosinase; EC 3.4.13.20 from Homo sapiens (Human) (see 4 papers)
27% identity, 96% coverage: 8:452/464 of query aligns to 38:494/507 of Q96KN2
Sites not aligning to the query:
3dljA Crystal structure of human carnosine dipeptidase 1
27% identity, 96% coverage: 8:452/464 of query aligns to 9:459/471 of 3dljA
3pfeA Crystal structure of a m20a metallo peptidase (dape, lpg0809) from legionella pneumophila subsp. Pneumophila str. Philadelphia 1 at 1.50 a resolution
26% identity, 79% coverage: 85:449/464 of query aligns to 92:456/471 of 3pfeA
4pqaA Crystal structure of succinyl-diaminopimelate desuccinylase from neisseria meningitidis mc58 in complex with the inhibitor captopril (see paper)
25% identity, 93% coverage: 18:449/464 of query aligns to 4:362/375 of 4pqaA
4o23A Crystal structure of mono-zinc form of succinyl diaminopimelate desuccinylase from neisseria meningitidis mc58 (see paper)
25% identity, 93% coverage: 18:449/464 of query aligns to 4:362/376 of 4o23A
7lgpB Dape enzyme from shigella flexneri
27% identity, 48% coverage: 20:244/464 of query aligns to 8:216/377 of 7lgpB
4op4B Crystal structure of the catalytic domain of dape protein from v.Cholerea in the zn bound form (see paper)
42% identity, 13% coverage: 82:143/464 of query aligns to 59:115/265 of 4op4B
Sites not aligning to the query:
3pfoA Crystal structure of a putative acetylornithine deacetylase (rpa2325) from rhodopseudomonas palustris cga009 at 1.90 a resolution
26% identity, 39% coverage: 5:187/464 of query aligns to 6:193/426 of 3pfoA
Sites not aligning to the query:
5vo3A Crystal structure of dape in complex with the products (succinic acid and diaminopimelic acid) (see paper)
26% identity, 47% coverage: 25:244/464 of query aligns to 15:219/380 of 5vo3A
Sites not aligning to the query:
P44514 Succinyl-diaminopimelate desuccinylase; SDAP desuccinylase; N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase; EC 3.5.1.18 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 3 papers)
26% identity, 47% coverage: 25:244/464 of query aligns to 11:215/377 of P44514
Sites not aligning to the query:
7t1qA Crystal structure of the succinyl-diaminopimelate desuccinylase (dape) from acinetobacter baumannii in complex with succinic acid
30% identity, 35% coverage: 81:244/464 of query aligns to 58:215/377 of 7t1qA
Sites not aligning to the query:
4h2kA Crystal structure of the catalytic domain of succinyl-diaminopimelate desuccinylase from haemophilus influenzae (see paper)
29% identity, 30% coverage: 25:164/464 of query aligns to 13:138/258 of 4h2kA
Sites not aligning to the query:
>SMc02852 FitnessBrowser__Smeli:SMc02852
MMADITPVLERADANLPQSLERLFDLVRIKSISTDPAFKAECRKAAEWLVAELGTLGFEA
SVRDTPGHPMVVAHHAAGKADAPHLLFYGHYDVQPVDPLNLWETPPFEPSLREVEPGRKI
ITGRGTADDKGQLMTFVEAVRAYKEARGVLPCRITILFEGEEESGSPSLKPFLEANAGEL
KADYALVCDTSMWDRETPAISAGLRGLVGEEVVVKAADRDLHSGYFGGAAANPIHILAEI
LAGLHDETGRVTLDDFYEGVEETPAEIKATWETLGQTAEKFLGEIGLSIPSGERGRSVLE
LTWARPTAEINGITGGYTGEGFKTVIAAEASAKVSFRLVGKQDPARIRESFRAYVRSKIP
ADCSIEFHAHGGSPAIHLPYDSALLTTAKAALSDEWPKPAVVIGMGGSIPIVGDFQRMLG
MESLLVGFGLSDDRIHSPNEKYELTSFHKGIRSWVRILDALGTR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory