Comparing SMc02864 FitnessBrowser__Smeli:SMc02864 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9VLJ8 Adenylyltransferase and sulfurtransferase MOCS3; Molybdenum cofactor synthesis protein 3; Ubiquitin activating enzyme 4; EC 2.7.7.80; EC 2.8.1.11 from Drosophila melanogaster (Fruit fly) (see paper)
47% identity, 96% coverage: 7:250/254 of query aligns to 64:300/453 of Q9VLJ8
Sites not aligning to the query:
Q72J02 Sulfur carrier protein adenylyltransferase; E1-like protein TtuC; Sulfur carrier protein MoaD adenylyltransferase; Sulfur carrier protein ThiS adenylyltransferase; Sulfur carrier protein TtuB adenylyltransferase; tRNA two-thiouridine-synthesizing protein C; EC 2.7.7.80; EC 2.7.7.73; EC 2.7.7.- from Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) (see paper)
54% identity, 96% coverage: 10:254/254 of query aligns to 6:248/271 of Q72J02
Sites not aligning to the query:
D4GSF3 SAMP-activating enzyme E1; Ubiquitin-like activating enzyme of archaea; Ubl-activating enzyme; EC 2.7.7.- from Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) (Halobacterium volcanii) (see paper)
52% identity, 96% coverage: 6:250/254 of query aligns to 4:240/270 of D4GSF3
O59954 Adenylyltransferase and sulfurtransferase uba4; Common component for nitrate reductase and xanthine dehydrogenase protein F; Ubiquitin-like protein activator 4; EC 2.7.7.80; EC 2.8.1.11 from Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans) (see paper)
46% identity, 94% coverage: 11:250/254 of query aligns to 65:309/482 of O59954
P38820 Adenylyltransferase and sulfurtransferase UBA4; Needs CLA4 to survive protein 3; Ubiquitin-like protein activator 4; EC 2.7.7.-; EC 2.8.1.- from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 4 papers)
44% identity, 95% coverage: 2:243/254 of query aligns to 34:272/440 of P38820
Sites not aligning to the query:
O95396 Adenylyltransferase and sulfurtransferase MOCS3; Molybdenum cofactor synthesis protein 3; Molybdopterin synthase sulfurylase; MPT synthase sulfurylase; EC 2.7.7.80; EC 2.8.1.11 from Homo sapiens (Human) (see 5 papers)
51% identity, 94% coverage: 5:244/254 of query aligns to 53:285/460 of O95396
Sites not aligning to the query:
P12282 Molybdopterin-synthase adenylyltransferase; MoaD protein adenylase; Molybdopterin-converting factor subunit 1 adenylase; Sulfur carrier protein MoaD adenylyltransferase; EC 2.7.7.80 from Escherichia coli (strain K12) (see 2 papers)
45% identity, 97% coverage: 5:251/254 of query aligns to 2:240/249 of P12282
Sites not aligning to the query:
1jwbB Structure of the covalent acyl-adenylate form of the moeb-moad protein complex (see paper)
44% identity, 97% coverage: 5:251/254 of query aligns to 1:232/240 of 1jwbB
Sites not aligning to the query:
1jw9B Structure of the native moeb-moad protein complex (see paper)
44% identity, 97% coverage: 5:251/254 of query aligns to 1:232/240 of 1jw9B
Sites not aligning to the query:
1jwaB Structure of the atp-bound moeb-moad protein complex (see paper)
42% identity, 97% coverage: 5:251/254 of query aligns to 1:217/217 of 1jwaB
6yubA Crystal structure of uba4 from chaetomium thermophilum (see paper)
41% identity, 87% coverage: 2:223/254 of query aligns to 1:213/423 of 6yubA
Sites not aligning to the query:
1zfnA Structural analysis of escherichia coli thif (see paper)
43% identity, 96% coverage: 11:253/254 of query aligns to 5:238/244 of 1zfnA
Sites not aligning to the query:
P30138 Sulfur carrier protein ThiS adenylyltransferase; EC 2.7.7.73 from Escherichia coli (strain K12) (see 3 papers)
43% identity, 96% coverage: 11:253/254 of query aligns to 5:238/251 of P30138
Sites not aligning to the query:
6yubB Crystal structure of uba4 from chaetomium thermophilum (see paper)
40% identity, 87% coverage: 2:223/254 of query aligns to 2:212/289 of 6yubB
Sites not aligning to the query:
1zud3 Structure of this-thif protein complex (see paper)
43% identity, 96% coverage: 11:253/254 of query aligns to 5:233/240 of 1zud3
Sites not aligning to the query:
O42939 Ubiquitin-activating enzyme E1-like; Pmt3-activating enzyme subunit 2 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
34% identity, 67% coverage: 30:198/254 of query aligns to 21:181/628 of O42939
Sites not aligning to the query:
3kydB Human sumo e1~sumo1-amp tetrahedral intermediate mimic (see paper)
30% identity, 81% coverage: 36:240/254 of query aligns to 16:227/477 of 3kydB
Sites not aligning to the query:
3kycB Human sumo e1 complex with a sumo1-amp mimic (see paper)
34% identity, 60% coverage: 36:187/254 of query aligns to 15:167/548 of 3kycB
Sites not aligning to the query:
1y8qB Sumo e1 activating enzyme sae1-sae2-mg-atp complex (see paper)
34% identity, 60% coverage: 36:187/254 of query aligns to 14:166/510 of 1y8qB
Sites not aligning to the query:
6xogB Structure of sumo1-ml786519 adduct bound to sae (see paper)
33% identity, 58% coverage: 36:182/254 of query aligns to 12:160/500 of 6xogB
Sites not aligning to the query:
>SMc02864 FitnessBrowser__Smeli:SMc02864
MTTDATLAPSEIARYARHIVLPEIGGPGQQKLKAARVLVIGAGGLGAPALQYLAAAGVGT
LGIVDDDVVSLSNLQRQVIHATADIGRPKVESAAAAIDALNPHVKVVAHPVRLGPANADA
LFRQYDLVVDGSDNFDTRYLAADTAEAAGVALVTGAVGRFDGSVTVLKPYGTDAEGHPNP
SYRDLFPEPPPPGTVPTCAEAGVLGALTGVIGTLQAMEAIKLVTGIGEPLIGRLLLYDAL
AAQFNTIRYRRGTR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory