SitesBLAST
Comparing SMc02870 FitnessBrowser__Smeli:SMc02870 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6jw6A The crystal structure of kand2 in complex with NAD (see paper)
29% identity, 64% coverage: 7:233/354 of query aligns to 1:230/341 of 6jw6A
- binding nicotinamide-adenine-dinucleotide: G8 (= G14), A9 (≠ L15), G10 (= G16), F11 (≠ N17), M12 (= M18), D33 (≠ N39), L34 (≠ R40), T70 (≠ N73), T71 (= T74), P72 (≠ Y75), N73 (≠ S76), L75 (≠ T78), H76 (= H79), Q79 (≠ Y82), E93 (= E96), K94 (= K97), N122 (≠ I125), W161 (= W161), H179 (= H180)
Sites not aligning to the query:
6jw8A The crystal structure of kand2 in complex with nadh and 3"-deamino-3"- hydroxykanamycin b (see paper)
29% identity, 64% coverage: 7:233/354 of query aligns to 1:230/342 of 6jw8A
- binding (2S,3R,4S,5S,6R)-2-[(1S,2S,3R,4S,6R)-3-[(2R,3R,4R,5S,6R)-6-(aminomethyl)-3-azanyl-4,5-bis(oxidanyl)oxan-2-yl]oxy-4,6-bis(azanyl)-2-oxidanyl-cyclohexyl]oxy-6-(hydroxymethyl)oxane-3,4,5-triol: F11 (≠ N17), F123 (≠ L126), F152 (≠ L152), N154 (≠ Q154), P157 (≠ S157), D175 (= D176), L176 (≠ C177), H179 (= H180)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G8 (= G14), A9 (≠ L15), G10 (= G16), F11 (≠ N17), M12 (= M18), H32 (≠ V38), D33 (≠ N39), L34 (≠ R40), T70 (≠ N73), T71 (= T74), P72 (≠ Y75), N73 (≠ S76), L75 (≠ T78), H76 (= H79), Q79 (≠ Y82), E93 (= E96), K94 (= K97), N122 (≠ I125), W161 (= W161), H179 (= H180)
Sites not aligning to the query:
- binding (2S,3R,4S,5S,6R)-2-[(1S,2S,3R,4S,6R)-3-[(2R,3R,4R,5S,6R)-6-(aminomethyl)-3-azanyl-4,5-bis(oxidanyl)oxan-2-yl]oxy-4,6-bis(azanyl)-2-oxidanyl-cyclohexyl]oxy-6-(hydroxymethyl)oxane-3,4,5-triol: 236, 254, 271, 272, 284, 290
- binding 1,4-dihydronicotinamide adenine dinucleotide: 290
6jw7A The crystal structure of kand2 in complex with nadh and 3"-deamino-3"- hydroxykanamycin a (see paper)
29% identity, 64% coverage: 7:233/354 of query aligns to 1:230/342 of 6jw7A
- binding (2R,3S,4S,5R,6R)-2-(aminomethyl)-6-[(1R,2S,3S,4R,6S)-4,6-bis(azanyl)-3-[(2S,3R,4S,5S,6R)-6-(hydroxymethyl)-3,4,5-tris(oxidanyl)oxan-2-yl]oxy-2-oxidanyl-cyclohexyl]oxy-oxane-3,4,5-triol: F11 (≠ N17), F123 (≠ L126), N154 (≠ Q154), P157 (≠ S157), D175 (= D176), L176 (≠ C177), H179 (= H180)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G8 (= G14), A9 (≠ L15), G10 (= G16), F11 (≠ N17), M12 (= M18), D33 (≠ N39), L34 (≠ R40), T70 (≠ N73), T71 (= T74), P72 (≠ Y75), N73 (≠ S76), L75 (≠ T78), H76 (= H79), Q79 (≠ Y82), E93 (= E96), K94 (= K97), N122 (≠ I125), W161 (= W161), H179 (= H180)
Sites not aligning to the query:
- binding (2R,3S,4S,5R,6R)-2-(aminomethyl)-6-[(1R,2S,3S,4R,6S)-4,6-bis(azanyl)-3-[(2S,3R,4S,5S,6R)-6-(hydroxymethyl)-3,4,5-tris(oxidanyl)oxan-2-yl]oxy-2-oxidanyl-cyclohexyl]oxy-oxane-3,4,5-triol: 236, 254, 271, 272, 284, 290
- binding 1,4-dihydronicotinamide adenine dinucleotide: 290
3ec7A Crystal structure of putative dehydrogenase from salmonella typhimurium lt2
26% identity, 49% coverage: 14:185/354 of query aligns to 9:181/336 of 3ec7A
- active site: K97 (= K97), H176 (= H180)
- binding nicotinamide-adenine-dinucleotide: G9 (= G14), G11 (= G16), M12 (≠ N17), I13 (≠ M18), C34 (≠ V38), D35 (≠ N39), I36 (vs. gap), V37 (vs. gap), R40 (= R40), Y58 (≠ F58), T73 (≠ N73), A74 (≠ T74), S75 (≠ Y75), N76 (≠ S76), A78 (≠ T78), H79 (= H79), E96 (= E96), K97 (= K97), M126 (≠ I125)
Sites not aligning to the query:
7xr9A Crystal structure of dgpa with glucose (see paper)
28% identity, 38% coverage: 51:184/354 of query aligns to 45:181/344 of 7xr9A
- binding beta-D-glucopyranose: K91 (= K97), R150 (≠ Q154), P155 (= P159), W157 (= W161), F160 (≠ H164), D173 (= D176), I174 (≠ C177), H177 (= H180)
- binding nicotinamide-adenine-dinucleotide: D51 (≠ S57), Y52 (≠ F58), C67 (≠ N73), T68 (= T74), P69 (≠ Y75), N70 (≠ S76), H73 (= H79), E90 (= E96), K91 (= K97), P92 (= P98), Q119 (≠ I125), V159 (≠ T163), F160 (≠ H164), Q166 (= Q169), H177 (= H180)
Sites not aligning to the query:
7xreC Crystal structure of dgpa
28% identity, 37% coverage: 53:184/354 of query aligns to 57:191/363 of 7xreC
- binding nicotinamide-adenine-dinucleotide: Y62 (≠ F58), C77 (≠ N73), T78 (= T74), P79 (≠ Y75), N80 (≠ S76), S82 (≠ T78), H83 (= H79), E100 (= E96), K101 (= K97), P102 (= P98), Q129 (≠ I125), V169 (≠ T163), F170 (≠ H164), Q176 (= Q169), H187 (= H180)
Sites not aligning to the query:
1evjA Crystal structure of glucose-fructose oxidoreductase (gfor) delta1-22 s64d (see paper)
31% identity, 34% coverage: 79:197/354 of query aligns to 82:205/340 of 1evjA
Sites not aligning to the query:
- binding nicotinamide-adenine-dinucleotide: 9, 10, 11, 12, 13, 35, 58, 76, 77, 78, 79, 267
1h6dA Oxidized precursor form of glucose-fructose oxidoreductase from zymomonas mobilis complexed with glycerol (see paper)
31% identity, 34% coverage: 79:197/354 of query aligns to 113:236/383 of 1h6dA
- active site: K131 (= K97), Y219 (≠ H180)
- binding glycerol: K131 (= K97), R202 (≠ A162), D215 (= D176), I216 (≠ C177), Y219 (≠ H180)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: H113 (= H79), E130 (= E96), K131 (= K97), P132 (= P98), R159 (≠ I125), A198 (≠ G158), W201 (= W161), R202 (≠ A162), Y219 (≠ H180)
Sites not aligning to the query:
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: 12, 13, 15, 16, 17, 18, 19, 40, 41, 42, 43, 44, 66, 67, 68, 71, 89, 107, 108, 109, 110, 112, 298
1rydA Crystal structure of glucose-fructose oxidoreductase from zymomonas mobilis
31% identity, 34% coverage: 79:197/354 of query aligns to 111:234/381 of 1rydA
Sites not aligning to the query:
- binding alpha-D-glucopyranose: 235, 236, 254, 256
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: 38, 39, 40, 41, 42, 64, 65, 69, 87, 105, 106, 107, 108, 110, 296
3e18A Crystal structure of NAD-binding protein from listeria innocua
23% identity, 67% coverage: 9:245/354 of query aligns to 5:240/348 of 3e18A
- active site: K94 (= K97), H178 (= H180)
- binding nicotinamide-adenine-dinucleotide: G10 (= G14), Y11 (≠ L15), G12 (= G16), G13 (≠ N17), M14 (= M18), F34 (vs. gap), D35 (vs. gap), I36 (vs. gap), L37 (= L37), K40 (≠ R40), A70 (≠ N73), T71 (= T74), P72 (≠ Y75), N73 (≠ S76), H76 (= H79), L79 (≠ Y82), E93 (= E96), K94 (= K97), P95 (= P98), H120 (≠ G123), N122 (≠ I125), W161 (= W161), R162 (≠ A162), H178 (= H180)
6norA Crystal structure of gend2 from gentamicin a biosynthesis in complex with NAD (see paper)
23% identity, 94% coverage: 22:354/354 of query aligns to 27:347/349 of 6norA
- binding nicotinamide-adenine-dinucleotide: V43 (= V38), D44 (≠ N39), R45 (= R40), D46 (vs. gap), A80 (≠ N73), T81 (= T74), P82 (≠ Y75), H86 (= H79), I89 (≠ Y82), E103 (= E96), K104 (= K97), N132 (≠ I125), T169 (≠ P159), W171 (= W161), F172 (≠ A162), H189 (= H180), Y301 (≠ P302)
Sites not aligning to the query:
5yaqB Crystal structure of scyllo-inositol dehydrogenase with l-glucose dehydrogenase activity complexed with scyllo-inosose (see paper)
32% identity, 38% coverage: 14:149/354 of query aligns to 8:154/366 of 5yaqB
- binding (2R,3S,4s,5R,6S)-2,3,4,5,6-pentahydroxycyclohexanone: F11 (≠ N17), K100 (= K97), Y129 (≠ L126)
- binding nicotinamide-adenine-dinucleotide: G8 (= G14), T9 (≠ L15), G10 (= G16), F11 (≠ N17), M12 (= M18), A38 (vs. gap), D39 (vs. gap), M40 (vs. gap), K44 (vs. gap), T76 (≠ N73), T77 (= T74), P78 (≠ Y75), N79 (≠ S76), L81 (≠ T78), H82 (= H79), M85 (≠ Y82), E99 (= E96), K100 (= K97), P101 (= P98), G126 (= G123), N128 (≠ I125), Y129 (≠ L126)
Sites not aligning to the query:
- binding (2R,3S,4s,5R,6S)-2,3,4,5,6-pentahydroxycyclohexanone: 157, 159, 161, 172, 185, 189
- binding nicotinamide-adenine-dinucleotide: 7, 171, 172, 189, 316
5ya8A Crystal structure of scyllo-inositol dehydrogenase with l-glucose dehydrogenase activity complexed with myo-inositol (see paper)
32% identity, 38% coverage: 14:149/354 of query aligns to 8:154/366 of 5ya8A
- binding 1,2,3,4,5,6-hexahydroxy-cyclohexane: K100 (= K97), Y129 (≠ L126)
- binding nicotinamide-adenine-dinucleotide: G8 (= G14), T9 (≠ L15), G10 (= G16), F11 (≠ N17), M12 (= M18), D39 (vs. gap), M40 (vs. gap), K44 (vs. gap), W61 (≠ F58), T76 (≠ N73), T77 (= T74), P78 (≠ Y75), N79 (≠ S76), L81 (≠ T78), H82 (= H79), M85 (≠ Y82), E99 (= E96), K100 (= K97), P101 (= P98), N128 (≠ I125), Y129 (≠ L126)
Sites not aligning to the query:
- binding 1,2,3,4,5,6-hexahydroxy-cyclohexane: 157, 159, 161, 172, 185, 186, 189
- binding nicotinamide-adenine-dinucleotide: 7, 171, 172, 189, 316
6ktkC Crystal structure of scyllo-inositol dehydrogenase r178a mutant, complexed with nadh and l-glucono-1,5-lactone, from paracoccus laeviglucosivorans (see paper)
32% identity, 38% coverage: 14:149/354 of query aligns to 9:155/368 of 6ktkC
- binding L-glucono-1,5-lactone: K101 (= K97), Y130 (≠ L126)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G9 (= G14), T10 (≠ L15), G11 (= G16), F12 (≠ N17), M13 (= M18), A39 (vs. gap), D40 (vs. gap), M41 (vs. gap), K45 (vs. gap), T77 (≠ N73), T78 (= T74), P79 (≠ Y75), N80 (≠ S76), L82 (≠ T78), H83 (= H79), M86 (≠ Y82), E100 (= E96), K101 (= K97), P102 (= P98), G127 (= G123), N129 (≠ I125)
Sites not aligning to the query:
7bvjA Udp-n-acetylglucosamine 3-dehydrogenase gnna from acidithiobacillus ferrooxidans (p21) (see paper)
28% identity, 53% coverage: 14:201/354 of query aligns to 10:185/313 of 7bvjA
- binding nicotinamide-adenine-dinucleotide: G10 (= G14), V11 (≠ L15), G12 (= G16), H13 (≠ N17), L14 (≠ M18), F32 (≠ V38), D33 (≠ N39), E34 (≠ R40), N35 (≠ S41), R38 (≠ A44), V67 (≠ N73), T68 (= T74), P69 (≠ Y75)
Sites not aligning to the query:
B3TMR8 dTDP-3,4-didehydro-2,6-dideoxy-alpha-D-glucose 3-reductase; 3-ketoreductase; NADPH-dependent C3-ketoreductase; EC 1.1.1.384 from Actinomadura kijaniata (see paper)
30% identity, 36% coverage: 3:131/354 of query aligns to 5:136/332 of B3TMR8
- 17:23 (vs. 15:21, 0% identical) binding
- SR 42:43 (≠ NR 39:40) binding
- Y63 (≠ F58) binding
- L79 (≠ T74) binding
- H84 (= H79) binding
- K102 (= K97) active site, Proton donor; mutation K->A,M,Q: Loss of reductase activity.; mutation to E: Retains some activity, but the catalytic efficiency is strongly reduced.
Sites not aligning to the query:
- 170 binding
- 182 binding
- 186 Y→F: Same affinity for dTDP-glucose and NADPH compared to the wild-type. Small reduction of the catalytic efficiency resulting from the conformational flexibility of the nicotinamide ring.
4l8vA Crystal structure of a12k/d35s mutant myo-inositol dehydrogenase from bacillus subtilis with bound cofactor NADP (see paper)
24% identity, 50% coverage: 8:185/354 of query aligns to 3:181/337 of 4l8vA
- active site: K97 (= K97), H176 (= H180)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G16), K12 (≠ N17), I13 (≠ M18), T73 (≠ N73), S74 (≠ T74), W75 (≠ Y75), G76 (≠ S76), H79 (= H79), E96 (= E96), K97 (= K97), P98 (= P98), M126 (≠ I125), H176 (= H180)
Sites not aligning to the query:
3rc1A Crystal structure of kijd10, a 3-ketoreductase from actinomadura kijaniata incomplex with NADP and tdp-benzene (see paper)
30% identity, 35% coverage: 7:131/354 of query aligns to 2:129/325 of 3rc1A
- active site: K95 (= K97)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G9 (= G14), C10 (≠ L15), A11 (≠ G16), D12 (≠ N17), I13 (≠ M18), S35 (≠ N39), R36 (= R40), R40 (vs. gap), Y56 (≠ F58), P71 (≠ N73), L72 (≠ T74), P73 (≠ Y75), A74 (≠ S76), L76 (≠ T78), H77 (= H79), E94 (= E96), K95 (= K97), M123 (≠ I125)
- binding 5'-O-[(S)-hydroxy{[(S)-hydroxy(phenoxy)phosphoryl]oxy}phosphoryl]thymidine: R16 (≠ S21), R17 (≠ H22)
Sites not aligning to the query:
- active site: 179
- binding nadp nicotinamide-adenine-dinucleotide phosphate: 162, 163, 168, 175, 179
- binding phosphate ion: 278, 283
- binding 5'-O-[(S)-hydroxy{[(S)-hydroxy(phenoxy)phosphoryl]oxy}phosphoryl]thymidine: 152, 154, 155, 157, 163, 179, 233, 253
3nt5A Crystal structure of myo-inositol dehydrogenase from bacillus subtilis with bound cofactor and product inosose (see paper)
24% identity, 50% coverage: 8:185/354 of query aligns to 3:181/337 of 3nt5A
- active site: K97 (= K97), H176 (= H180)
- binding (2R,3S,4s,5R,6S)-2,3,4,5,6-pentahydroxycyclohexanone: K97 (= K97), R127 (≠ L126), H155 (≠ L152), N157 (≠ Q154), D172 (= D176), H176 (= H180)
- binding nicotinamide-adenine-dinucleotide: I8 (≠ A13), G9 (= G14), T10 (≠ L15), G11 (= G16), A12 (≠ N17), I13 (≠ M18), T34 (≠ V38), D35 (≠ N39), V36 (≠ R40), N37 (≠ S41), S74 (≠ T74), W75 (≠ Y75), G76 (≠ S76), A78 (≠ T78), H79 (= H79), E96 (= E96), K97 (= K97), M126 (≠ I125)
Sites not aligning to the query:
3nt4A Crystal structure of myo-inositol dehydrogenase from bacillus subtilis with bound cofactor nadh and inositol (see paper)
24% identity, 50% coverage: 8:185/354 of query aligns to 3:181/337 of 3nt4A
- active site: K97 (= K97), H176 (= H180)
- binding 1,2,3,4,5,6-hexahydroxy-cyclohexane: K97 (= K97), H155 (≠ L152), N157 (≠ Q154), H176 (= H180)
- binding 1,4-dihydronicotinamide adenine dinucleotide: I8 (≠ A13), G9 (= G14), G11 (= G16), A12 (≠ N17), I13 (≠ M18), T34 (≠ V38), D35 (≠ N39), V36 (≠ R40), N37 (≠ S41), T73 (≠ N73), S74 (≠ T74), W75 (≠ Y75), G76 (≠ S76), A78 (≠ T78), H79 (= H79), E96 (= E96), K97 (= K97), G124 (= G123), M126 (≠ I125), H176 (= H180)
Sites not aligning to the query:
Query Sequence
>SMc02870 FitnessBrowser__Smeli:SMc02870
MNSSAPPIRVLSAGLGNMGRSHALAYHQNPGFEIAGLVNRSKVALPEALAGYEILPSFPE
ALAELEPELCSINTYSDTHADYAVMAMEAGAHVFVEKPLATTVADAERVVACARANGRKL
VVGYILRHHPSWMRLIAEARKLGGPYVFRMNLNQQSSGPTWATHKSLMQTTPPIVDCGVH
YVDVMCQITDANPVEVRGMGLRLSNEIAADMYNYGHLQVIFEDGSVGWYEAGWGPMISET
AFFVKDVMSPNGSVSIVMDQNAKSDDIDVHTKTSVIRVHSAATGPDGRFLKSDEDLVMEG
EPGHQELCDREQAFVLKAIREDIDLGRHMDDAVQSLKICLAADDSVRTGKPVKL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory