Comparing SMc02873 FitnessBrowser__Smeli:SMc02873 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6preA Sbp rafe in complex with verbascose (see paper)
26% identity, 73% coverage: 26:332/419 of query aligns to 1:309/386 of 6preA
Sites not aligning to the query:
2i58A Crystal structure of rafe from streptococcus pneumoniae complexed with raffinose
26% identity, 73% coverage: 27:332/419 of query aligns to 1:308/385 of 2i58A
Sites not aligning to the query:
7ehpA Chitin oligosaccharide binding protein (see paper)
28% identity, 68% coverage: 125:408/419 of query aligns to 104:386/397 of 7ehpA
Sites not aligning to the query:
4c1tA Structure of the xylo-oligosaccharide specific solute binding protein from bifidobacterium animalis subsp. Lactis bl-04 in complex with arabinoxylotriose (see paper)
25% identity, 91% coverage: 30:409/419 of query aligns to 4:391/396 of 4c1tA
4zs9B Raffinose and panose binding protein from bifidobacterium animalis subsp. Lactis bl-04, bound with raffinose (see paper)
24% identity, 88% coverage: 40:408/419 of query aligns to 14:377/378 of 4zs9B
Sites not aligning to the query:
4zs9A Raffinose and panose binding protein from bifidobacterium animalis subsp. Lactis bl-04, bound with raffinose (see paper)
25% identity, 71% coverage: 113:408/419 of query aligns to 82:376/377 of 4zs9A
Sites not aligning to the query:
4zzeA Raffinose and panose binding protein from bifidobacterium animalis subsp. Lactis bl-04, bound with panose (see paper)
25% identity, 71% coverage: 113:408/419 of query aligns to 82:376/377 of 4zzeA
Sites not aligning to the query:
3k02A Crystal structures of the gach receptor of streptomyces glaucescens gla.O in the unliganded form and in complex with acarbose and an acarbose homolog. Comparison with acarbose-loaded maltose binding protein of salmonella typhimurium. (see paper)
23% identity, 90% coverage: 44:419/419 of query aligns to 21:388/388 of 3k02A
Sites not aligning to the query:
3jzjA Crystal structures of the gach receptor of streptomyces glaucescens gla.O in the unliganded form and in complex with acarbose and an acarbose homolog. Comparison with acarbose-loaded maltose binding protein of salmonella typhimurium. (see paper)
23% identity, 90% coverage: 44:419/419 of query aligns to 21:388/388 of 3jzjA
Sites not aligning to the query:
3oo6A Crystal structures and biochemical characterization of the bacterial solute receptor acbh reveal an unprecedented exclusive substrate preference for b-d-galactopyranose (see paper)
30% identity, 37% coverage: 115:270/419 of query aligns to 92:243/390 of 3oo6A
Sites not aligning to the query:
7ehqA Chitin oligosaccharide binding protein (see paper)
33% identity, 35% coverage: 125:270/419 of query aligns to 108:254/406 of 7ehqA
Sites not aligning to the query:
7c0kB Crystal structure of a dinucleotide-binding protein of abc transporter endogenously bound to uridylyl-3'-5'-phospho-guanosine (form ii) (see paper)
25% identity, 58% coverage: 128:371/419 of query aligns to 118:346/397 of 7c0kB
Sites not aligning to the query:
7c0kA Crystal structure of a dinucleotide-binding protein of abc transporter endogenously bound to uridylyl-3'-5'-phospho-guanosine (form ii) (see paper)
25% identity, 58% coverage: 128:371/419 of query aligns to 117:345/396 of 7c0kA
Sites not aligning to the query:
7c0oB Crystal structure of a dinucleotide-binding protein (y56f) of abc transporter endogenously bound to uridylyl-3'-5'-phospho-guanosine (see paper)
25% identity, 58% coverage: 128:371/419 of query aligns to 117:345/397 of 7c0oB
Sites not aligning to the query:
6rjyA The crystal structure of abne, an arabino-oligosaccharide binding protein, in complex with arabinobiose (see paper)
23% identity, 67% coverage: 46:327/419 of query aligns to 21:313/415 of 6rjyA
Sites not aligning to the query:
7yzuA Crystal structure of the sulfoquinovosyl binding protein smof complexed with sqme (see paper)
24% identity, 89% coverage: 41:411/419 of query aligns to 14:378/382 of 7yzuA
Sites not aligning to the query:
2b3fA Thermus thermophilus glucose/galactose binding protein bound with galactose (see paper)
24% identity, 77% coverage: 29:352/419 of query aligns to 3:323/392 of 2b3fA
Sites not aligning to the query:
2b3bC Thermus thermophilus glucose/galactose binding protein with bound glucose (see paper)
24% identity, 77% coverage: 29:352/419 of query aligns to 3:323/392 of 2b3bC
Sites not aligning to the query:
2b3bA Thermus thermophilus glucose/galactose binding protein with bound glucose (see paper)
24% identity, 77% coverage: 29:352/419 of query aligns to 3:323/392 of 2b3bA
Sites not aligning to the query:
4g68A Biochemical and structural insights into xylan utilization by the thermophilic bacteriumcaldanaerobius polysaccharolyticus (see paper)
23% identity, 55% coverage: 44:272/419 of query aligns to 19:247/392 of 4g68A
Sites not aligning to the query:
>SMc02873 FitnessBrowser__Smeli:SMc02873
MTRTTMKGLLLASSILGSAGLAQAQDATLTIESWRNDDLAIWQEKLIPAFEAKNPGIKVV
FAPSAPTEYNAALNAKLDAGSAGDLITCRPFDASLELYNKKHLADLTGLSGMENFSDVAK
SAWTTDDGKATFCVPMASVIHGFIYNKDAFDQLGLSVPATEEEFFAVLEKIKADGNYIPM
AMGTKDLWEAATMGYQNIGPNYWKGEEGRLALLKGEQKLTDEPWVEPFRVLAKWKDYLGD
GFEAQTYPDSQNLFTLGRAAIYPAGSWEISGFNTQAEFKMGAFPPPVKKAGDTCYISDHN
DIGIGLNAKSKNADAAKTFLTWVASPEFAEIYANALPGFFSLNSTAVKMSDPLAQEFVSW
REKCKPTIRSTYQILSRGTPNLENETWVMSANVINGTDTPEAAAKKLQDGLDSWFKPVK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory