Comparing SMc02875 FitnessBrowser__Smeli:SMc02875 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
2e2oA Crystal structure of sulfolobus tokodaii hexokinase in complex with glucose (see paper)
28% identity, 87% coverage: 5:260/294 of query aligns to 4:260/299 of 2e2oA
2e2qA Crystal structure of sulfolobus tokodaii hexokinase in complex with xylose, mg2+, and adp (see paper)
28% identity, 87% coverage: 5:260/294 of query aligns to 4:260/297 of 2e2qA
2e2pA Crystal structure of sulfolobus tokodaii hexokinase in complex with adp (see paper)
28% identity, 87% coverage: 5:260/294 of query aligns to 4:260/298 of 2e2pA
P81799 N-acetyl-D-glucosamine kinase; N-acetylglucosamine kinase; GlcNAc kinase; Muramyl dipeptide kinase; N-acetyl-D-mannosamine kinase; EC 2.7.1.59; EC 2.7.1.-; EC 2.7.1.60 from Rattus norvegicus (Rat) (see paper)
26% identity, 86% coverage: 7:258/294 of query aligns to 7:276/343 of P81799
Sites not aligning to the query:
2ch6A Crystal structure of human n-acetylglucosamine kinase in complex with adp and glucose (see paper)
25% identity, 86% coverage: 7:258/294 of query aligns to 6:275/343 of 2ch6A
Q9UJ70 N-acetyl-D-glucosamine kinase; N-acetylglucosamine kinase; GlcNAc kinase; Muramyl dipeptide kinase; N-acetyl-D-mannosamine kinase; EC 2.7.1.59; EC 2.7.1.-; EC 2.7.1.60 from Homo sapiens (Human) (see 5 papers)
26% identity, 75% coverage: 7:226/294 of query aligns to 7:238/344 of Q9UJ70
Sites not aligning to the query:
8oqxA Crystal structure of tannerella forsythia murnac kinase murk with a phosphate analogue (see paper)
28% identity, 36% coverage: 97:201/294 of query aligns to 91:193/283 of 8oqxA
Sites not aligning to the query:
8ow9A Crystal structure of tannerella forsythia murnac kinase murk in complex with n-acetylmuramic acid (murnac) (see paper)
28% identity, 36% coverage: 97:201/294 of query aligns to 91:193/277 of 8ow9A
Sites not aligning to the query:
>SMc02875 FitnessBrowser__Smeli:SMc02875
MTFYLIGIDGGGTSCRAAVAALDGRILGRGKAGAANILTDPETALQNITDAARDAFGDAG
LDPAGIGASRAIVGVAGHNVGDAVHYVKRRLPFAQADIESDGLIALQGALGDGDGAVAIL
GTGTIYIARRGDEVSYVGGWGFTIGDHGSGARIGHALLQESLLAYDGIHQGSGVTDAVLA
EFNDDPRDIVDFARLAKPGEFGRYAPRVFEFAERGDPVAISLLKAAAATVDEALDVVVSR
GSEKLCLLGGLAPLYRRWLADRHQPRFVEARADALTGAVALAAARFGSHSGVSA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory