Comparing SMc02880 FitnessBrowser__Smeli:SMc02880 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7p9pAAA Ubiquitin-like protein SMT3,N-acetyl-D-glucosamine kinase
35% identity, 98% coverage: 1:298/303 of query aligns to 3:304/304 of 7p9pAAA
7p7wBBB Ubiquitin-like protein SMT3,N-acetyl-D-glucosamine kinase
35% identity, 98% coverage: 1:298/303 of query aligns to 5:306/306 of 7p7wBBB
7p9lAAA Ubiquitin-like protein SMT3,N-acetyl-D-glucosamine kinase
35% identity, 98% coverage: 1:298/303 of query aligns to 2:303/303 of 7p9lAAA
4db3A 1.95 angstrom resolution crystal structure of n-acetyl-d-glucosamine kinase from vibrio vulnificus.
31% identity, 99% coverage: 1:300/303 of query aligns to 9:311/311 of 4db3A
Q8ZPZ9 N-acetyl-D-glucosamine kinase; GlcNAc kinase; EC 2.7.1.59 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
32% identity, 98% coverage: 1:296/303 of query aligns to 1:299/303 of Q8ZPZ9
2ap1A Crystal structure of the putative regulatory protein
32% identity, 98% coverage: 1:296/303 of query aligns to 3:301/305 of 2ap1A
Q93LQ8 Beta-glucoside kinase; EC 2.7.1.85 from Klebsiella pneumoniae (see paper)
34% identity, 50% coverage: 2:154/303 of query aligns to 3:155/297 of Q93LQ8
2qm1B Crystal structure of glucokinase from enterococcus faecalis
28% identity, 97% coverage: 2:296/303 of query aligns to 8:318/325 of 2qm1B
P50456 DNA-binding transcriptional repressor Mlc; Making large colonies protein; Membrane linked control from Escherichia coli (strain K12) (see 4 papers)
25% identity, 79% coverage: 57:296/303 of query aligns to 149:390/406 of P50456
Sites not aligning to the query:
1z6rA Crystal structure of mlc from escherichia coli (see paper)
25% identity, 79% coverage: 57:296/303 of query aligns to 125:366/382 of 1z6rA
3vglA Crystal structure of a rok family glucokinase from streptomyces griseus in complex with glucose and amppnp (see paper)
29% identity, 98% coverage: 1:296/303 of query aligns to 2:308/312 of 3vglA
3vgkB Crystal structure of a rok family glucokinase from streptomyces griseus (see paper)
29% identity, 98% coverage: 1:296/303 of query aligns to 2:308/312 of 3vgkB
1z05A Crystal structure of the rok family transcriptional regulator, homolog of e.Coli mlc protein.
24% identity, 87% coverage: 33:296/303 of query aligns to 119:380/396 of 1z05A
2gupA Structural genomics, the crystal structure of a rok family protein from streptococcus pneumoniae tigr4 in complex with sucrose
31% identity, 53% coverage: 2:161/303 of query aligns to 3:157/289 of 2gupA
Sites not aligning to the query:
3vovB Crystal structure of rok hexokinase from thermus thermophilus (see paper)
29% identity, 74% coverage: 76:298/303 of query aligns to 79:292/298 of 3vovB
6jdoA Crystal structure of n-acetyl mannosmaine kinase with amp-pnp from pasteurella multocida
25% identity, 96% coverage: 3:294/303 of query aligns to 4:283/293 of 6jdoA
6jdhA Crystal structure of n-acetyl mannosmaine kinase from pasteurella multocida
25% identity, 96% coverage: 3:294/303 of query aligns to 4:283/293 of 6jdhA
P32718 D-allose kinase; Allokinase; EC 2.7.1.55 from Escherichia coli (strain K12) (see paper)
26% identity, 67% coverage: 72:273/303 of query aligns to 83:269/309 of P32718
Sites not aligning to the query:
5f7rA Rok repressor lmo0178 from listeria monocytogenes bound to inducer (see paper)
25% identity, 69% coverage: 57:264/303 of query aligns to 64:267/306 of 5f7rA
Sites not aligning to the query:
6jdbA Crystal structure of n-acetyl mannosmaine kinase in complex with mannac-6p and adp from haemophilus influenzae
23% identity, 97% coverage: 3:295/303 of query aligns to 4:283/290 of 6jdbA
>SMc02880 FitnessBrowser__Smeli:SMc02880
MIVCFDIGGSAIKGAITHSPERIFPLPRRATPLTDFGRFVEAMESVLDEAGGLPERVAIS
ITGVIDPETRRIKCANIPCIDGRELVAELEAALHLPVVIANDADCFALAEAGVGAGRGHR
IVFGAILGTGVGGGLVIDGRLINADGGFAGEWGHGPAVAAAAGHPPIAIPAFPCGCGQSR
CVDTVGGARGLERLHETVHGKALSSHDIIEGWQNGNAEAARTIDVFVDLVSSPLALVINI
TGATIVPVGGGLSNAEALLAEIDRAVRARILRRFDRPLVVRGECRVEPGLIGAALLGFGG
RSA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory