Comparing SMc03003 FitnessBrowser__Smeli:SMc03003 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
P32171 L-Rhamnulokinase; RhaB; RhuK; ATP:L-rhamnulose phosphotransferase; L-rhamnulose 1-kinase; Rhamnulose kinase; EC 2.7.1.5 from Escherichia coli (strain K12) (see paper)
26% identity, 57% coverage: 1:262/462 of query aligns to 1:263/489 of P32171
Sites not aligning to the query:
Q1R415 Rhamnulokinase; Rhamnulose kinase; EC 2.7.1.5 from Escherichia coli (strain UTI89 / UPEC) (see paper)
25% identity, 57% coverage: 1:262/462 of query aligns to 1:263/489 of Q1R415
Sites not aligning to the query:
2uytA Structure of l-rhamnulose kinase in complex with adp and beta-l- rhamnulose. (see paper)
26% identity, 56% coverage: 3:262/462 of query aligns to 2:262/479 of 2uytA
Sites not aligning to the query:
2cglA Crystal structure of l-rhamnulose kinase from escherichia coli in complex with l-fructose, adp and a modeled atp gamma phosphate. (see paper)
26% identity, 56% coverage: 3:262/462 of query aligns to 2:262/479 of 2cglA
Sites not aligning to the query:
2cgjA Crystal structure of l-rhamnulose kinase from escherichia coli in complex with l-fructose and adp. (see paper)
26% identity, 56% coverage: 3:262/462 of query aligns to 2:262/479 of 2cgjA
Sites not aligning to the query:
3kzbA Crystal structure of xylulokinase from chromobacterium violaceum
26% identity, 85% coverage: 6:398/462 of query aligns to 6:422/498 of 3kzbA
P09099 Xylulose kinase; XK; Xylulokinase; 1-deoxy-D-xylulokinase; EC 2.7.1.17; EC 2.7.1.- from Escherichia coli (strain K12) (see paper)
27% identity, 35% coverage: 9:171/462 of query aligns to 5:169/484 of P09099
Sites not aligning to the query:
2itmA Crystal structure of the e. Coli xylulose kinase complexed with xylulose (see paper)
27% identity, 35% coverage: 9:171/462 of query aligns to 5:169/476 of 2itmA
Sites not aligning to the query:
>SMc03003 FitnessBrowser__Smeli:SMc03003
MMMKTVAVIDIGKTNAKVALVDLERFEEIAVRKSGNGVSDDGPYPHFDTERLWRFVLDSL
AALHREHPVDAISVTTHGATAVLLDEAGELALPVLDYEFTGPDALAEEYEKARPPFTETG
SARLPMGLNVGAQLFWQQRMFPEHFARVATILTYAQYWSYRLTGVRTNELTSLGCHTDLW
NPKAATFSSMVDEQGWRHLFAPVRRAGDVLGPLLRQVADETGLPPETPVHCGIHDSNASL
LPHLITRQAPFSVASTGTWVVMLAVGAEPVKLDERRDTLINVNALGDPVPSARFMGGRAY
SLLIGDDPPTASPEAEASVLEQGHMLLPSLPGGSGPFPAARPHWTADEDKLAPAERLAVV
SFHLALMTATCLDLIGARGEILVEGPFALNDAYLRMLAAATGRPVLANRLNSTGTSLGAA
CLVAGARVRTGAEAIPAAKPDAYAAYAEAWRRRTAAHVRSDP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory