SitesBLAST
Comparing SMc03064 FitnessBrowser__Smeli:SMc03064 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3wy2A Crystal structure of alpha-glucosidase in complex with glucose (see paper)
56% identity, 97% coverage: 17:551/551 of query aligns to 4:535/535 of 3wy2A
- active site: D97 (= D110), R197 (= R210), D199 (= D212), E268 (= E281), H329 (= H344), D330 (= D345)
- binding beta-D-glucopyranose: D59 (= D72), Y62 (= Y75), H102 (= H115), R197 (= R210), D199 (= D212), E268 (= E281), H329 (= H344), D330 (= D345), R397 (= R413)
- binding glycerol: S101 (= S114), D169 (= D182), V170 (≠ L183), P175 (= P188), R178 (≠ Q191), Q179 (≠ E192), F203 (= F216), Y204 (= Y217), H206 (= H219), D240 (= D253), P244 (= P257), E280 (= E294)
- binding magnesium ion: D20 (= D33), R22 (≠ N35), V26 (≠ I39), D28 (= D41)
3wy1A Crystal structure of alpha-glucosidase (see paper)
56% identity, 97% coverage: 17:551/551 of query aligns to 4:535/535 of 3wy1A
- active site: D97 (= D110), R197 (= R210), D199 (= D212), E268 (= E281), H329 (= H344), D330 (= D345)
- binding glycerol: S101 (= S114), D169 (= D182), V170 (≠ L183), F203 (= F216), Y204 (= Y217), H206 (= H219)
- binding magnesium ion: D20 (= D33), D24 (= D37), V26 (≠ I39), D28 (= D41)
- binding (3R,5R,7R)-octane-1,3,5,7-tetracarboxylic acid: D59 (= D72), Y62 (= Y75), H102 (= H115), F144 (= F157), F163 (= F176), R197 (= R210), D199 (= D212), T200 (= T213), G225 (≠ T238), E268 (= E281), F294 (= F308), H329 (= H344), D330 (= D345), R397 (= R413)
3wy4A Crystal structure of alpha-glucosidase mutant e271q in complex with maltose (see paper)
56% identity, 97% coverage: 17:551/551 of query aligns to 4:535/535 of 3wy4A
- active site: D97 (= D110), R197 (= R210), D199 (= D212), Q268 (≠ E281), H329 (= H344), D330 (= D345)
- binding alpha-D-glucopyranose: D59 (= D72), Y62 (= Y75), H102 (= H115), I143 (= I156), F163 (= F176), D199 (= D212), T200 (= T213), G225 (≠ T238), Q268 (≠ E281), Q268 (≠ E281), F294 (= F308), H329 (= H344), D330 (= D345), R397 (= R413), R397 (= R413)
- binding glycerol: S101 (= S114), D169 (= D182), V170 (≠ L183), F203 (= F216), Y204 (= Y217), H206 (= H219), L224 (≠ S237), G225 (≠ T238), A226 (= A239), P227 (= P240), F294 (= F308), D330 (= D345), E374 (= E390), K395 (= K411), G396 (= G412), G399 (= G415)
- binding magnesium ion: D20 (= D33), D24 (= D37), V26 (≠ I39), D28 (= D41)
3wy4B Crystal structure of alpha-glucosidase mutant e271q in complex with maltose (see paper)
55% identity, 67% coverage: 17:385/551 of query aligns to 4:323/421 of 3wy4B
- active site: D75 (= D110), R175 (= R210), D177 (= D212), Q237 (≠ E281)
- binding glycerol: S79 (= S114), N140 (= N175), D147 (= D182), F181 (= F216), Y182 (= Y217), F183 (= F218), H184 (= H219), D209 (= D253)
2ze0A Alpha-glucosidase gsj (see paper)
38% identity, 92% coverage: 15:522/551 of query aligns to 2:497/531 of 2ze0A
5wczA Crystal structure of wild-type mall from bacillus subtilis with ts analogue 1-deoxynojirimycin (see paper)
35% identity, 91% coverage: 16:517/551 of query aligns to 1:518/556 of 5wczA
- active site: D95 (= D110), R195 (= R210), D197 (= D212), E250 (= E281), H326 (= H344), D327 (= D345)
- binding 1-deoxynojirimycin: D57 (= D72), Y60 (= Y75), H100 (= H115), F161 (= F176), D197 (= D212), V198 (≠ T213), E250 (= E281), H326 (= H344), D327 (= D345), R413 (= R413)
4mazA The structure of mall mutant enzyme v200s from bacillus subtilus (see paper)
35% identity, 91% coverage: 16:517/551 of query aligns to 1:521/559 of 4mazA
4m56A The structure of wild-type mall from bacillus subtilis (see paper)
35% identity, 91% coverage: 16:517/551 of query aligns to 1:518/555 of 4m56A
- active site: D95 (= D110), R195 (= R210), D197 (= D212), E250 (= E281), H326 (= H344), D327 (= D345)
- binding D-glucose: D57 (= D72), Y60 (= Y75), H100 (= H115), F142 (= F157), D197 (= D212), E250 (= E281), D327 (= D345), R413 (= R413)
7lv6B The structure of mall mutant enzyme s536r from bacillus subtilis
35% identity, 91% coverage: 16:517/551 of query aligns to 1:521/559 of 7lv6B
O06994 Oligo-1,6-glucosidase 1; Dextrin 6-alpha-D-glucanohydrolase; Oligosaccharide alpha-1,6-glucosidase 1; Sucrase-isomaltase 1; Isomaltase 1; EC 3.2.1.10 from Bacillus subtilis (strain 168) (see paper)
35% identity, 91% coverage: 16:517/551 of query aligns to 3:523/561 of O06994
- D20 (= D33) binding
- N22 (= N35) binding
- D24 (= D37) binding
- F26 (≠ I39) binding
- D28 (= D41) binding
8ibkA Crystal structure of bacillus sp. Ahu2216 gh13_31 alpha-glucosidase e256q/n258g in complex with maltotriose (see paper)
35% identity, 91% coverage: 15:517/551 of query aligns to 1:510/546 of 8ibkA
- binding calcium ion: D19 (= D33), N21 (= N35), D23 (= D37), I25 (= I39), D27 (= D41)
- binding alpha-D-glucopyranose: D58 (= D72), Y61 (= Y75), H101 (= H115), I141 (= I156), F161 (= F176), D197 (= D212), A198 (≠ T213), H201 (= H219), M227 (≠ I251), Q254 (≠ E281), Q254 (≠ E281), F280 (= F308), H320 (= H344), D321 (= D345), R405 (= R413)
Sites not aligning to the query:
4h8vA Crystal structure of the trehalulose synthase mutb in complex with trehalulose
36% identity, 92% coverage: 12:517/551 of query aligns to 1:519/557 of 4h8vA
- active site: D99 (= D110), R198 (= R210), D200 (= D212), E254 (= E281), H326 (= H344), D327 (= D345)
- binding calcium ion: D22 (= D33), N24 (= N35), D26 (= D37), I28 (= I39), D30 (= D41)
- binding 1-O-alpha-D-glucopyranosyl-D-fructose: D61 (= D72), Y64 (= Y75), H104 (= H115), F164 (= F176), D200 (= D212), E254 (= E281), F256 (≠ G283), R284 (≠ A312), R291 (≠ Q319), H326 (= H344), D327 (= D345), E386 (≠ Q405), R414 (= R413)
2pwdA Crystal structure of the trehalulose synthase mutb from pseudomonas mesoacidophila mx-45 complexed to the inhibitor deoxynojirmycin (see paper)
36% identity, 92% coverage: 12:517/551 of query aligns to 1:519/557 of 2pwdA
- active site: D99 (= D110), R198 (= R210), D200 (= D212), E254 (= E281), H326 (= H344), D327 (= D345)
- binding calcium ion: D22 (= D33), N24 (= N35), D26 (= D37), I28 (= I39), D30 (= D41)
- binding 1-deoxynojirimycin: D61 (= D72), Y64 (= Y75), H104 (= H115), F164 (= F176), D200 (= D212), E254 (= E281), H326 (= H344), D327 (= D345), R414 (= R413)
2pwgA Crystal structure of the trehalulose synthase mutb from pseudomonas mesoacidophila mx-45 complexed to the inhibitor castanospermine (see paper)
36% identity, 92% coverage: 13:517/551 of query aligns to 1:518/556 of 2pwgA
- active site: D98 (= D110), R197 (= R210), D199 (= D212), E253 (= E281), H325 (= H344), D326 (= D345)
- binding calcium ion: D21 (= D33), N23 (= N35), D25 (= D37), I27 (= I39), D29 (= D41)
- binding castanospermine: D60 (= D72), Y63 (= Y75), H103 (= H115), F163 (= F176), D199 (= D212), E253 (= E281), D326 (= D345), R413 (= R413)
2pweA Crystal structure of the mutb e254q mutant in complex with the substrate sucrose (see paper)
36% identity, 92% coverage: 13:517/551 of query aligns to 1:518/556 of 2pweA
- active site: D98 (= D110), R197 (= R210), D199 (= D212), Q253 (≠ G280), H325 (= H344), D326 (= D345)
- binding calcium ion: D21 (= D33), N23 (= N35), D25 (= D37), I27 (= I39), D29 (= D41)
- binding beta-D-fructofuranose: F163 (= F176), Q253 (≠ G280), F255 (≠ V282), D326 (= D345), R413 (= R413)
- binding alpha-D-glucopyranose: D60 (= D72), Y63 (= Y75), H103 (= H115), F163 (= F176), D199 (= D212), Q253 (≠ G280), H325 (= H344), D326 (= D345), R413 (= R413)
2pwfA Crystal structure of the mutb d200a mutant in complex with glucose (see paper)
36% identity, 91% coverage: 17:517/551 of query aligns to 4:517/555 of 2pwfA
- active site: D97 (= D110), R196 (= R210), A198 (≠ D212), E252 (= E281), H324 (= H344), D325 (= D345)
- binding beta-D-glucopyranose: D59 (= D72), Y62 (= Y75), H102 (= H115), F162 (= F176), R196 (= R210), A198 (≠ D212), E252 (= E281), H324 (= H344), D325 (= D345), R412 (= R413)
- binding calcium ion: D20 (= D33), N22 (= N35), D24 (= D37), I26 (= I39), D28 (= D41)
4howA The crystal structure of isomaltulose synthase from erwinia rhapontici nx5 (see paper)
35% identity, 97% coverage: 17:550/551 of query aligns to 6:557/559 of 4howA
4ha1A Mutb inactive double mutant d200a-d415n in complex with isomaltulose
36% identity, 92% coverage: 13:517/551 of query aligns to 1:518/556 of 4ha1A
- active site: D98 (= D110), R197 (= R210), A199 (≠ D212), E253 (= E281), H325 (= H344), D326 (= D345)
- binding calcium ion: D21 (= D33), N23 (= N35), D25 (= D37), I27 (= I39), D29 (= D41)
- binding 6-O-alpha-D-glucopyranosyl-D-fructose: D60 (= D72), Y63 (= Y75), H103 (= H115), F163 (= F176), E253 (= E281), R283 (≠ A312), H325 (= H344), D326 (= D345), E385 (≠ Q405), R413 (= R413)
4hphA The crystal structure of isomaltulose synthase mutant e295q from erwinia rhapontici nx5 in complex with its natural substrate sucrose (see paper)
35% identity, 97% coverage: 17:550/551 of query aligns to 6:557/559 of 4hphA
- active site: D99 (= D110), R198 (= R210), D200 (= D212), Q254 (≠ E281), H327 (= H344), D328 (= D345)
- binding calcium ion: D22 (= D33), N24 (= N35), D26 (= D37), I28 (= I39), D30 (= D41)
- binding beta-D-fructofuranose: F164 (= F176), Q254 (≠ E281), F256 (≠ G283), D328 (= D345), E387 (≠ Y402), R415 (= R413)
- binding alpha-D-glucopyranose: D61 (= D72), Y64 (= Y75), H104 (= H115), F164 (= F176), D200 (= D212), Q254 (≠ E281), H327 (= H344), D328 (= D345), R415 (= R413)
3gbeA Crystal structure of the isomaltulose synthase smua from protaminobacter rubrum in complex with the inhibitor deoxynojirimycin (see paper)
35% identity, 91% coverage: 17:517/551 of query aligns to 5:519/558 of 3gbeA
- active site: D98 (= D110), R197 (= R210), D199 (= D212), E253 (= E281), H326 (= H344), D327 (= D345)
- binding 1-deoxynojirimycin: D60 (= D72), Y63 (= Y75), H103 (= H115), F163 (= F176), R197 (= R210), D199 (= D212), H326 (= H344), D327 (= D345), R414 (= R413)
Query Sequence
>SMc03064 FitnessBrowser__Smeli:SMc03064
MTMNETTSSLLEPDRDWWRGAVIYQIYPRSFQDTNGDGIGDLQGITARLPHIAGLGADAI
WISPFFTSPMRDFGYDVSNYVDVDPIFGTLEDFDALIAEAHRLGLRVMIDLVLSHTSDRH
PWFVESRSSRSNAKADWYVWADSKPDGTPPNNWLSIFGGSAWQWDPTRLQYYLHNFLTSQ
PDLNLHNPQVQEALLAVERFWLERGVDGFRLDTINFYFHDRELRDNPALVPERRNASTAP
AVNPYNYQEHIYDKNRPENLEFLKRFRAVMDEFPAIAAVGEVGDSQRGLEIAGEYTSGGD
KVHMCYAFEFLAPDRLTPQRVAEVLRDFHRAAPEGWACWAFSNHDVVRHVSRWADGVTDH
DAHAKLLASLLMSLRGTVCIYQGEELALAEAELDYEDLQDPYGIQFWPDFKGRDGCRTPM
VWESLPDGGFSSATPWLPISQSHIPRAVAVQEGDPASVLHHYRRFLAFRKANPALAKGEI
EFVETRGSLLGFLRSHGNEKVFCLFNMSDEAATKELPMKRLEPLEGHGFVSEILDHEVKL
PAWGAFFARLA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory