SitesBLAST
Comparing SMc03103 SMc03103 carbon monoxide dehydrogenase medium subunit transmembrane protein to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 13 hits to proteins with known functional sites (download)
4zohB Crystal structure of glyceraldehyde oxidoreductase (see paper)
35% identity, 96% coverage: 11:265/265 of query aligns to 13:272/274 of 4zohB
- active site: Y256 (= Y249)
- binding flavin-adenine dinucleotide: R28 (≠ K26), P29 (≠ Y27), A31 (≠ S29), G32 (= G30), G33 (= G31), H34 (≠ M32), S35 (≠ T33), L36 (= L34), H77 (= H75), I95 (= I98), G96 (= G99), V100 (= V103), T105 (= T108), G108 (= G111), S109 (= S112), S111 (≠ A114), A117 (= A120), D118 (= D121), L160 (≠ I159), V161 (= V160), D185 (≠ R182), F186 (≠ Y183)
1ffuC Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor (see paper)
39% identity, 75% coverage: 5:203/265 of query aligns to 7:217/287 of 1ffuC
- binding flavin-adenine dinucleotide: K29 (= K26), L30 (≠ Y27), A32 (≠ S29), G33 (= G30), G34 (= G31), H35 (≠ M32), S36 (≠ T33), L37 (= L34), I54 (≠ L51), I101 (= I98), A102 (≠ G99), G110 (= G107), T111 (= T108), G114 (= G111), D115 (≠ S112), A117 (= A114), N123 (≠ A120), D124 (= D121), L161 (= L154), V166 (≠ I159), M167 (≠ V160), W193 (≠ Y183)
1n5wC Crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form (see paper)
41% identity, 73% coverage: 5:197/265 of query aligns to 7:207/287 of 1n5wC
P19920 Carbon monoxide dehydrogenase medium chain; CO dehydrogenase subunit M; CO-DH M; EC 1.2.5.3 from Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5) (Oligotropha carboxidovorans) (see 2 papers)
41% identity, 73% coverage: 5:197/265 of query aligns to 7:207/288 of P19920
7dqxE Crystal structure of xanthine dehydrogenase family protein
30% identity, 98% coverage: 5:265/265 of query aligns to 7:283/293 of 7dqxE
- binding flavin-adenine dinucleotide: K29 (= K26), I30 (≠ Y27), I31 (≠ L28), G33 (= G30), G34 (= G31), Q35 (≠ M32), S36 (≠ T33), L37 (= L34), H78 (= H75), I101 (= I98), A102 (≠ G99), I106 (≠ V103), G110 (= G107), T111 (= T108), G113 (= G110), G114 (= G111), S115 (= S112), A117 (= A114), A123 (= A120), E124 (≠ D121), I167 (≠ V160), Y193 (= Y183)
1t3qC Crystal structure of quinoline 2-oxidoreductase from pseudomonas putida 86 (see paper)
30% identity, 98% coverage: 5:265/265 of query aligns to 7:279/285 of 1t3qC
- binding flavin-adenine dinucleotide: I29 (≠ Y27), A31 (≠ S29), G32 (= G30), G33 (= G31), Q34 (≠ M32), S35 (≠ T33), L36 (= L34), V100 (≠ I98), A101 (≠ G99), V105 (= V103), T110 (= T108), G113 (= G111), S114 (= S112), A116 (= A114), A122 (= A120), E123 (≠ D121), L166 (≠ V160), Y190 (= Y183)
3hrdG Crystal structure of nicotinate dehydrogenase (see paper)
29% identity, 75% coverage: 1:198/265 of query aligns to 1:212/292 of 3hrdG
- binding flavin-adenine dinucleotide: I29 (≠ Y27), A31 (≠ S29), G32 (= G30), G33 (= G31), T34 (≠ M32), D35 (≠ T33), F77 (≠ H75), V100 (≠ I98), G101 (= G99), I105 (≠ V103), T110 (= T108), G113 (= G111), N114 (≠ S112), S116 (≠ A114), T117 (≠ N115), G122 (≠ A120), D123 (= D121), I168 (= I159), M169 (≠ V160)
Q0QLF4 Nicotinate dehydrogenase FAD-subunit; NDH; Nicotinic acid hydroxylase FAD-subunit; NAH; EC 1.17.1.5 from Eubacterium barkeri (Clostridium barkeri) (see paper)
29% identity, 75% coverage: 1:198/265 of query aligns to 1:212/296 of Q0QLF4
- 29:36 (vs. 27:34, 38% identical) binding
- G101 (= G99) binding
- TIGGN 110:114 (≠ TIGGS 108:112) binding
- D123 (= D121) binding
- R160 (vs. gap) binding
- M169 (≠ V160) binding
- K187 (≠ N178) binding
1jroA Crystal structure of xanthine dehydrogenase from rhodobacter capsulatus (see paper)
32% identity, 66% coverage: 89:262/265 of query aligns to 249:435/450 of 1jroA
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 42, 43, 189, 191, 192, 193, 194, 195, 196
- binding fe2/s2 (inorganic) cluster: 37, 38, 39, 40, 42, 44, 45, 47, 63, 103, 106, 134, 136
2w54A Crystal structure of xanthine dehydrogenase from rhodobacter capsulatus in complex with bound inhibitor pterin-6-aldehyde (see paper)
32% identity, 66% coverage: 89:262/265 of query aligns to 249:435/450 of 2w54A
- binding flavin-adenine dinucleotide: F258 (≠ I98), A259 (≠ G99), A267 (≠ G107), T268 (= T108), G271 (= G111), N272 (≠ S112), A274 (= A114), N275 (= N115), G280 (≠ A120), D281 (= D121), R318 (≠ L154), V324 (= V160), Q347 (≠ N178)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 42, 189, 191, 192, 193, 194, 195, 196, 199, 213
- binding fe2/s2 (inorganic) cluster: 38, 39, 40, 42, 44, 45, 47, 63, 103, 104, 106, 134, 135, 136
- binding {[(5aR,8R,9aR)-2-amino-4-oxo-6,7-di(sulfanyl-kappaS)-3,5,5a,8,9a,10-hexahydro-4H-pyrano[3,2-g]pteridin-8-yl]methyl dihydrogenato(2-) phosphate}(hydroxy)oxo(thioxo)molybdenum: 102, 136
O33820 4-hydroxybenzoyl-CoA reductase subunit beta; 4-HBCR subunit beta; EC 1.1.7.1 from Thauera aromatica (see paper)
26% identity, 97% coverage: 7:262/265 of query aligns to 10:317/324 of O33820
- 29:36 (vs. 28:34, 38% identical) binding
- T111 (= T108) binding
- N115 (≠ S112) binding
- Q118 (≠ N115) binding
- D162 (= D121) binding
- K224 (= K175) binding
1rm6B Structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica (see paper)
26% identity, 97% coverage: 7:262/265 of query aligns to 10:317/323 of 1rm6B
- binding flavin-adenine dinucleotide: P29 (vs. gap), G31 (≠ S29), A32 (≠ G30), G33 (= G31), T34 (≠ M32), D35 (≠ T33), L36 (= L34), L53 (= L51), V101 (≠ I98), A102 (≠ G99), A110 (≠ G107), T111 (= T108), G114 (= G111), N115 (≠ S112), C117 (≠ A114), Q118 (≠ N115), D162 (= D121), L207 (≠ V160), V231 (≠ S181), D232 (≠ R182), F233 (≠ Y183)
- binding iron/sulfur cluster: C122 (≠ A119), F124 (vs. gap), C138 (vs. gap), C146 (vs. gap), H147 (vs. gap), V148 (vs. gap), C155 (vs. gap), Y156 (vs. gap), A157 (vs. gap)
5y6qB Crystal structure of an aldehyde oxidase from methylobacillus sp. Ky4400 (see paper)
25% identity, 66% coverage: 1:175/265 of query aligns to 1:227/330 of 5y6qB
- binding flavin-adenine dinucleotide: I26 (≠ Y27), A28 (≠ S29), G29 (= G30), G30 (= G31), T31 (≠ M32), T32 (= T33), Q33 (≠ L34), A97 (≠ I98), A98 (≠ G99), I102 (≠ V103), A106 (≠ G107), T107 (= T108), G110 (= G111), N111 (≠ S112), R113 (≠ A114), Q114 (≠ N115), G164 (≠ A124), D165 (vs. gap), I213 (= I159), I214 (≠ V160)
- binding iron/sulfur cluster: C118 (vs. gap), Y121 (vs. gap), C130 (vs. gap), N131 (vs. gap), C139 (vs. gap), A141 (vs. gap), C158 (vs. gap), I159 (vs. gap), A160 (= A120)
Sites not aligning to the query:
Query Sequence
>SMc03103 SMc03103 carbon monoxide dehydrogenase medium subunit transmembrane protein
MYETNYHRASSVEEAANLMGTAAEGKYLSGGMTLIPTMKQRLAAPSDLVDLRHIAEMKGI
TVDGRSVRIGAATTHEEVATSAALAAACPAICGLASHIGDPHVRHMGTIGGSIANNDPAA
DYPAAMLALDAVIVTDRREVKAEDFFTGLFETALEDGEIVTAVRFEAPAKAAYQKFPNPA
SRYAMTGVFVVRRDDGGVRVAVTGAGSDGVFRHRDLEAALAANWSPGAVANVQVDDSDLL
SDIHASAAYRANLVKVMTKRAVAAA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory