SitesBLAST
Comparing SMc03104 FitnessBrowser__Smeli:SMc03104 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P18079 5-aminolevulinate synthase; 5-aminolevulinic acid synthase; Delta-ALA synthase; Delta-aminolevulinate synthase; EC 2.3.1.37 from Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) (see paper)
58% identity, 100% coverage: 2:405/405 of query aligns to 1:407/409 of P18079
- R21 (= R22) binding
- S137 (= S137) binding
- K156 (≠ R156) binding
- S189 (= S189) binding in other chain
- H217 (= H217) binding in other chain
- T245 (= T245) binding in other chain
- K248 (= K248) active site
- S277 (≠ T277) binding
- T278 (= T278) binding
- T365 (= T363) binding
2bwoB 5-aminolevulinate synthase from rhodobacter capsulatus in complex with succinyl-coa (see paper)
57% identity, 98% coverage: 2:397/405 of query aligns to 1:399/399 of 2bwoB
- active site: N54 (= N54), H142 (= H142), E185 (= E185), S189 (= S189), D214 (= D214), H217 (= H217), K248 (= K248)
- binding pyridoxal-5'-phosphate: S114 (= S114), A115 (≠ G115), Y116 (= Y116), H142 (= H142), E185 (= E185), S189 (= S189), D214 (= D214), V216 (= V216), H217 (= H217), T245 (= T245), K248 (= K248)
- binding succinyl-coenzyme a: R21 (= R22), T83 (= T83), N85 (= N85), S137 (= S137), S139 (≠ A139), H142 (= H142), I146 (= I146), K150 (≠ R150), K156 (≠ R156), I158 (= I158), F276 (= F276), F363 (≠ Y361), P364 (= P362), T365 (= T363)
2bwpA 5-aminolevulinate synthase from rhodobacter capsulatus in complex with glycine (see paper)
57% identity, 98% coverage: 2:396/405 of query aligns to 1:398/398 of 2bwpA
- active site: N54 (= N54), H142 (= H142), E185 (= E185), S189 (= S189), D214 (= D214), H217 (= H217), K248 (= K248)
- binding n-glycine-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-yl-methane]: N54 (= N54), A115 (≠ G115), Y116 (= Y116), H142 (= H142), E185 (= E185), D214 (= D214), V216 (= V216), H217 (= H217), T245 (= T245), K248 (= K248), S277 (≠ T277), T278 (= T278)
P08680 5-aminolevulinate synthase, erythroid-specific, mitochondrial; ALAS-E; 5-aminolevulinic acid synthase 2; Delta-ALA synthase 2; Delta-aminolevulinate synthase 2; EC 2.3.1.37 from Mus musculus (Mouse) (see 2 papers)
51% identity, 98% coverage: 4:400/405 of query aligns to 145:545/587 of P08680
- K391 (= K248) modified: N6-(pyridoxal phosphate)lysine; mutation K->A,H: Abolishes enzyme activity.
Sites not aligning to the query:
- 1:49 modified: transit peptide, Mitochondrion
6hrhA Structure of human erythroid-specific 5'-aminolevulinate synthase, alas2
50% identity, 99% coverage: 1:400/405 of query aligns to 6:403/429 of 6hrhA
- binding pyridoxal-5'-phosphate: S115 (= S114), C116 (≠ G115), F117 (≠ Y116), H143 (= H142), E186 (= E185), S190 (= S189), D215 (= D214), H218 (= H217), T246 (= T245), K249 (= K248), T278 (= T277), T279 (= T278)
5qreA Pandda analysis group deposition -- crystal structure of human alas2a in complex with z117233350
50% identity, 99% coverage: 1:400/405 of query aligns to 6:403/429 of 5qreA
- binding pyridoxal-5'-phosphate: C116 (≠ G115), F117 (≠ Y116), H143 (= H142), E186 (= E185), S190 (= S189), D215 (= D214), V217 (= V216), H218 (= H217), T246 (= T245), K249 (= K248), T278 (= T277), T279 (= T278)
Sites not aligning to the query:
5qrcA Pandda analysis group deposition -- crystal structure of human alas2a in complex with z31721798
50% identity, 99% coverage: 1:400/405 of query aligns to 6:403/429 of 5qrcA
- binding 3-cyclohexyl-1-(morpholin-4-yl)propan-1-one: K129 (≠ S128), I130 (≠ K129), Y271 (≠ F270)
- binding pyridoxal-5'-phosphate: S115 (= S114), C116 (≠ G115), F117 (≠ Y116), H143 (= H142), E186 (= E185), S190 (= S189), D215 (= D214), V217 (= V216), H218 (= H217), K249 (= K248), T278 (= T277), T279 (= T278)
5qraA Pandda analysis group deposition -- crystal structure of human alas2a in complex with z1101755952
50% identity, 99% coverage: 1:400/405 of query aligns to 6:403/429 of 5qraA
- binding [(4R)-4-methyl-2,3,4,5-tetrahydro-1H-azepin-1-yl](1,3-thiazol-4-yl)methanone: K129 (≠ S128), I130 (≠ K129), Y271 (≠ F270)
- binding pyridoxal-5'-phosphate: S115 (= S114), C116 (≠ G115), F117 (≠ Y116), H143 (= H142), E186 (= E185), S190 (= S189), D215 (= D214), V217 (= V216), H218 (= H217), T246 (= T245), K249 (= K248), T278 (= T277), T279 (= T278)
5qr9A Pandda analysis group deposition -- crystal structure of human alas2a in complex with z31478129
50% identity, 99% coverage: 1:400/405 of query aligns to 6:403/429 of 5qr9A
- binding ethyl benzylcarbamate: H206 (≠ D205), L211 (≠ M210), D241 (≠ T240)
- binding pyridoxal-5'-phosphate: S115 (= S114), C116 (≠ G115), F117 (≠ Y116), H143 (= H142), E186 (= E185), S190 (= S189), D215 (= D214), V217 (= V216), H218 (= H217), K249 (= K248), T278 (= T277), T279 (= T278)
5qr3A Pandda analysis group deposition -- crystal structure of human alas2a in complex with z915492990
50% identity, 99% coverage: 1:400/405 of query aligns to 6:403/429 of 5qr3A
- binding 1-methyl-N-[(thiophen-2-yl)methyl]-1H-pyrazole-5-carboxamide: M6 (= M1), F7 (≠ M2)
- binding pyridoxal-5'-phosphate: S115 (= S114), C116 (≠ G115), F117 (≠ Y116), H143 (= H142), E186 (= E185), S190 (= S189), D215 (= D214), V217 (= V216), H218 (= H217), K249 (= K248), T278 (= T277), T279 (= T278)
5qr1A Pandda analysis group deposition -- crystal structure of human alas2a in complex with z396380540
50% identity, 99% coverage: 1:400/405 of query aligns to 6:403/429 of 5qr1A
- binding ~{N}-(cyclobutylmethyl)-1,5-dimethyl-pyrazole-4-carboxamide: I130 (≠ K129), Y271 (≠ F270)
- binding pyridoxal-5'-phosphate: S115 (= S114), C116 (≠ G115), F117 (≠ Y116), H143 (= H142), E186 (= E185), S190 (= S189), D215 (= D214), V217 (= V216), H218 (= H217), T246 (= T245), K249 (= K248), T278 (= T277), T279 (= T278)
5qr0A Pandda analysis group deposition -- crystal structure of human alas2a in complex with z730649594
50% identity, 99% coverage: 1:400/405 of query aligns to 6:403/429 of 5qr0A
- binding N-[2-(4-hydroxyphenyl)ethyl]pyridine-2-carboxamide: H206 (≠ D205), L211 (≠ M210), D241 (≠ T240), T261 (≠ S260), L264 (= L263), E300 (= E297), A303 (≠ V300), A307 (= A304), P380 (= P377), H381 (≠ M378)
- binding pyridoxal-5'-phosphate: S115 (= S114), C116 (≠ G115), F117 (≠ Y116), H143 (= H142), E186 (= E185), S190 (= S189), D215 (= D214), V217 (= V216), H218 (= H217), K249 (= K248), T278 (= T277), T279 (= T278)
5qqyA Pandda analysis group deposition -- crystal structure of human alas2a in complex with z2856434899
50% identity, 99% coverage: 1:400/405 of query aligns to 6:403/429 of 5qqyA
- binding 1-[(2,5-dihydrothiophen-3-yl)methyl]piperidin-4-ol: K16 (≠ E11), E19 (≠ G14), K129 (≠ S128), Y271 (≠ F270)
- binding pyridoxal-5'-phosphate: S115 (= S114), C116 (≠ G115), F117 (≠ Y116), H143 (= H142), E186 (= E185), S190 (= S189), D215 (= D214), V217 (= V216), H218 (= H217), T246 (= T245), K249 (= K248), T278 (= T277), T279 (= T278)
Sites not aligning to the query:
5qqxA Pandda analysis group deposition -- crystal structure of human alas2a in complex with z373768900
50% identity, 99% coverage: 1:400/405 of query aligns to 6:403/429 of 5qqxA
- binding pyridoxal-5'-phosphate: S115 (= S114), C116 (≠ G115), F117 (≠ Y116), H143 (= H142), E186 (= E185), S190 (= S189), D215 (= D214), V217 (= V216), H218 (= H217), K249 (= K248), T278 (= T277), T279 (= T278)
Sites not aligning to the query:
5qqwA Pandda analysis group deposition -- crystal structure of human alas2a in complex with z136583524
50% identity, 99% coverage: 1:400/405 of query aligns to 6:403/429 of 5qqwA
- binding 2-methyl-N-(pyridin-4-yl)furan-3-carboxamide: F125 (≠ G124), T126 (= T125), K129 (≠ S128)
- binding pyridoxal-5'-phosphate: S115 (= S114), C116 (≠ G115), F117 (≠ Y116), H143 (= H142), E186 (= E185), S190 (= S189), D215 (= D214), V217 (= V216), H218 (= H217), T246 (= T245), K249 (= K248), T278 (= T277), T279 (= T278)
5qquA Pandda analysis group deposition -- crystal structure of human alas2a in complex with z1348371854
50% identity, 99% coverage: 1:400/405 of query aligns to 6:403/429 of 5qquA
- binding 5-(1,4-oxazepan-4-yl)pyridine-2-carbonitrile: Q65 (≠ I64), Q68 (≠ E67), R151 (= R150), N152 (≠ H151), G154 (≠ K153)
- binding pyridoxal-5'-phosphate: S115 (= S114), C116 (≠ G115), F117 (≠ Y116), H143 (= H142), E186 (= E185), S190 (= S189), D215 (= D214), V217 (= V216), H218 (= H217), T246 (= T245), K249 (= K248), T278 (= T277), T279 (= T278)
5qqtA Pandda analysis group deposition -- crystal structure of human alas2a in complex with z2856434834
50% identity, 99% coverage: 1:400/405 of query aligns to 6:403/429 of 5qqtA
- binding N-(2,3-dimethylphenyl)-2-(morpholin-4-yl)acetamide: H206 (≠ D205), Q207 (≠ K206)
- binding pyridoxal-5'-phosphate: S115 (= S114), C116 (≠ G115), F117 (≠ Y116), H143 (= H142), E186 (= E185), S190 (= S189), D215 (= D214), V217 (= V216), H218 (= H217), K249 (= K248), T278 (= T277), T279 (= T278)
5qqsA Pandda analysis group deposition -- crystal structure of human alas2a in complex with z275151340
50% identity, 99% coverage: 1:400/405 of query aligns to 6:403/429 of 5qqsA
- binding 4-chloro-N-cyclopentyl-1-methyl-1H-pyrazole-3-carboxamide: H206 (≠ D205), G209 (= G208)
- binding pyridoxal-5'-phosphate: S115 (= S114), C116 (≠ G115), F117 (≠ Y116), H143 (= H142), E186 (= E185), S190 (= S189), D215 (= D214), V217 (= V216), H218 (= H217), T246 (= T245), K249 (= K248), T278 (= T277), T279 (= T278)
5qqqA Pandda analysis group deposition -- crystal structure of human alas2a in complex with z2856434857
50% identity, 99% coverage: 1:400/405 of query aligns to 6:403/429 of 5qqqA
- binding 3-[(thiomorpholin-4-yl)methyl]phenol: A210 (= A209), L211 (≠ M210), D241 (≠ T240), T261 (≠ S260)
- binding pyridoxal-5'-phosphate: C116 (≠ G115), F117 (≠ Y116), H143 (= H142), E186 (= E185), S190 (= S189), D215 (= D214), V217 (= V216), H218 (= H217), T246 (= T245), K249 (= K248), T278 (= T277), T279 (= T278)
5qrdB Pandda analysis group deposition -- crystal structure of human alas2a in complex with z1328968520
50% identity, 99% coverage: 1:400/405 of query aligns to 6:404/428 of 5qrdB
- binding pyridoxal-5'-phosphate: S116 (= S114), C117 (≠ G115), F118 (≠ Y116), N121 (= N119), H144 (= H142), E187 (= E185), D216 (= D214), V218 (= V216), H219 (= H217), T247 (= T245), K250 (= K248), T279 (= T277), T280 (= T278)
Sites not aligning to the query:
Query Sequence
>SMc03104 FitnessBrowser__Smeli:SMc03104
MMDFESFFKNELDGLHQEGRYRVFADLARHRGSFPKATRYTADGAQEVTVWCSNDYLGMG
QCPIVTEAMKNAIDECGAGAGGTRNISGTNHYHVLLERELADLHGKESALLFTSGYVSNW
AALGTLCSKIPGVIVFSDAGNHASMIEGIRHSKCERVIFKHNSVADLEAKLAAADPRAPK
IIAFESVYSMDGDIAPIREFCDLADKYGAMTYLDEVHAVGMYGPRGGGIAEREGLMHRLT
VIEGTLGKAFGVMGGYITGSAALCDFIRSFASGFIFTTALPPALAAGALASIRHLKESQV
ERFAHQERVRRLRSLLDQRGIPHMVNPSHIVPVIVGDAAKCKWISDLLLDNFGIYVQPIN
YPTVPKKTERLRITPTPMHSDADIDHLVSALHSLWSRCALARAVA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory