Comparing SMc03109 FitnessBrowser__Smeli:SMc03109 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4db3A 1.95 angstrom resolution crystal structure of n-acetyl-d-glucosamine kinase from vibrio vulnificus.
43% identity, 99% coverage: 1:295/298 of query aligns to 9:307/311 of 4db3A
7p9pAAA Ubiquitin-like protein SMT3,N-acetyl-D-glucosamine kinase
42% identity, 99% coverage: 1:295/298 of query aligns to 3:302/304 of 7p9pAAA
7p9lAAA Ubiquitin-like protein SMT3,N-acetyl-D-glucosamine kinase
42% identity, 99% coverage: 1:295/298 of query aligns to 2:301/303 of 7p9lAAA
7p7wBBB Ubiquitin-like protein SMT3,N-acetyl-D-glucosamine kinase
42% identity, 99% coverage: 1:295/298 of query aligns to 5:304/306 of 7p7wBBB
Q8ZPZ9 N-acetyl-D-glucosamine kinase; GlcNAc kinase; EC 2.7.1.59 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
39% identity, 99% coverage: 1:295/298 of query aligns to 1:299/303 of Q8ZPZ9
2ap1A Crystal structure of the putative regulatory protein
39% identity, 99% coverage: 1:295/298 of query aligns to 3:301/305 of 2ap1A
2qm1B Crystal structure of glucokinase from enterococcus faecalis
30% identity, 98% coverage: 3:295/298 of query aligns to 9:318/325 of 2qm1B
3vglA Crystal structure of a rok family glucokinase from streptomyces griseus in complex with glucose and amppnp (see paper)
31% identity, 98% coverage: 1:293/298 of query aligns to 2:306/312 of 3vglA
3vgkB Crystal structure of a rok family glucokinase from streptomyces griseus (see paper)
31% identity, 98% coverage: 1:293/298 of query aligns to 2:306/312 of 3vgkB
5f7qE Rok repressor lmo0178 from listeria monocytogenes bound to operator (see paper)
28% identity, 79% coverage: 60:295/298 of query aligns to 145:384/396 of 5f7qE
Sites not aligning to the query:
3vovB Crystal structure of rok hexokinase from thermus thermophilus (see paper)
37% identity, 98% coverage: 3:293/298 of query aligns to 4:288/298 of 3vovB
5f7rA Rok repressor lmo0178 from listeria monocytogenes bound to inducer (see paper)
28% identity, 79% coverage: 60:295/298 of query aligns to 64:300/306 of 5f7rA
Sites not aligning to the query:
1z05A Crystal structure of the rok family transcriptional regulator, homolog of e.Coli mlc protein.
27% identity, 67% coverage: 59:257/298 of query aligns to 138:340/396 of 1z05A
2gupA Structural genomics, the crystal structure of a rok family protein from streptococcus pneumoniae tigr4 in complex with sucrose
28% identity, 86% coverage: 5:259/298 of query aligns to 6:243/289 of 2gupA
Sites not aligning to the query:
6jdoA Crystal structure of n-acetyl mannosmaine kinase with amp-pnp from pasteurella multocida
25% identity, 99% coverage: 3:298/298 of query aligns to 4:288/293 of 6jdoA
6jdhA Crystal structure of n-acetyl mannosmaine kinase from pasteurella multocida
25% identity, 99% coverage: 3:298/298 of query aligns to 4:288/293 of 6jdhA
Q93LQ8 Beta-glucoside kinase; EC 2.7.1.85 from Klebsiella pneumoniae (see paper)
25% identity, 99% coverage: 5:298/298 of query aligns to 6:287/297 of Q93LQ8
6jdbA Crystal structure of n-acetyl mannosmaine kinase in complex with mannac-6p and adp from haemophilus influenzae
26% identity, 99% coverage: 3:298/298 of query aligns to 4:287/290 of 6jdbA
2yi1A Crystal structure of n-acetylmannosamine kinase in complex with n- acetyl mannosamine 6-phosphate and adp. (see paper)
27% identity, 84% coverage: 3:253/298 of query aligns to 6:264/308 of 2yi1A
2yhyA Structure of n-acetylmannosamine kinase in complex with n- acetylmannosamine and adp (see paper)
27% identity, 84% coverage: 3:253/298 of query aligns to 6:264/308 of 2yhyA
>SMc03109 FitnessBrowser__Smeli:SMc03109
MFIGIDWGGTKMEVIALDRDGETRARHRVPTPTSGYEDCIRAVVELVASAESTAGERGSI
GIGIPGSPNPRTGIVRNSNAVLINGKPLGRDLAAALGREVRLANDANCLAVSEAVDGAGK
DAGVVFGVIVGTGHGGGLAIGKKVHAGYQGVAAEIGHYPLPWMTKDEYPGHRCWCGKLGC
LDMYACGTGLELDYRMTTGTDRRGRDIIEAKRAGDPVAIGVYGRFVDRLARSLALLTNIV
DPDVFVLGGGMSNVDEIYGELPASITRYLFGDSFETPIRKAVHGDSSGVRGAAWLWKD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory