Comparing SMc03120 SMc03120 ABC transporter ATP-binding protein to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
30% identity, 89% coverage: 15:247/262 of query aligns to 4:231/501 of P04983
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
30% identity, 92% coverage: 15:256/262 of query aligns to 4:253/254 of 1g6hA
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
30% identity, 92% coverage: 15:256/262 of query aligns to 4:253/253 of 1g9xB
1ji0A Crystal structure analysis of the abc transporter from thermotoga maritima
30% identity, 93% coverage: 14:256/262 of query aligns to 5:238/240 of 1ji0A
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
30% identity, 93% coverage: 15:258/262 of query aligns to 2:237/240 of 6mjpA
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
29% identity, 93% coverage: 16:258/262 of query aligns to 3:237/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
29% identity, 93% coverage: 16:258/262 of query aligns to 3:237/238 of 6s8gA
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
29% identity, 92% coverage: 16:256/262 of query aligns to 3:235/235 of 6mhzA
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
28% identity, 90% coverage: 15:249/262 of query aligns to 2:228/241 of 4u00A
6mbnA Lptb e163q in complex with atp (see paper)
29% identity, 93% coverage: 16:258/262 of query aligns to 4:238/241 of 6mbnA
3c4jA Abc protein artp in complex with atp-gamma-s
29% identity, 87% coverage: 21:249/262 of query aligns to 9:230/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
29% identity, 87% coverage: 21:249/262 of query aligns to 9:230/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
29% identity, 87% coverage: 21:249/262 of query aligns to 9:230/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
29% identity, 87% coverage: 21:249/262 of query aligns to 9:230/242 of 2oljA
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
29% identity, 92% coverage: 16:255/262 of query aligns to 3:234/234 of 6b89A
4p31A Crystal structure of a selenomethionine derivative of e. Coli lptb in complex with adp-magensium (see paper)
29% identity, 92% coverage: 16:255/262 of query aligns to 3:234/234 of 4p31A
6b8bA E. Coli lptb in complex with adp and a novobiocin derivative (see paper)
29% identity, 91% coverage: 16:254/262 of query aligns to 3:233/233 of 6b8bA
P0AAH0 Phosphate import ATP-binding protein PstB; ABC phosphate transporter; Phosphate-transporting ATPase; EC 7.3.2.1 from Escherichia coli (strain K12) (see paper)
28% identity, 84% coverage: 16:236/262 of query aligns to 11:231/257 of P0AAH0
Sites not aligning to the query:
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
30% identity, 83% coverage: 23:239/262 of query aligns to 9:218/240 of 4ymuJ
7chaI Cryo-em structure of p.Aeruginosa mlafebd with amppnp (see paper)
25% identity, 92% coverage: 19:260/262 of query aligns to 7:245/262 of 7chaI
>SMc03120 SMc03120 ABC transporter ATP-binding protein
MTVAMPLENGAPRVVLSARGLRRDFGGFTAVKDVDLDVHHARVHALIGPNGAGKTTVFNL
LTKFLQPTHGTITLLGEDITRTAPDKVARMGLVRSFQISAVFPHLTVLDNVRVALQRPNR
LATQFWKSLSSLDTLNGKAEQLIRSVGLDKEANAVAADLSYGRKRVLEIATTLALEPKVL
LLDEPMAGMGHEDVGMVAEIIREVARERAVLMVEHNLSVVATLCHHVTVLQRGEILAEGD
YATVSEDPRVRTAYMGTEEASR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory