Comparing SMc03125 FitnessBrowser__Smeli:SMc03125 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0AAH4 Putrescine export system ATP-binding protein SapD from Escherichia coli (strain K12) (see paper)
37% identity, 86% coverage: 8:297/337 of query aligns to 3:305/330 of P0AAH4
Q8RDH4 Dipeptide transport ATP-binding protein DppD; EC 7.4.2.9 from Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) (Thermoanaerobacter tengcongensis) (see paper)
33% identity, 88% coverage: 8:302/337 of query aligns to 4:303/326 of Q8RDH4
Sites not aligning to the query:
4fwiB Crystal structure of the nucleotide-binding domain of a dipeptide abc transporter (see paper)
33% identity, 88% coverage: 8:302/337 of query aligns to 3:292/310 of 4fwiB
Sites not aligning to the query:
3c4jA Abc protein artp in complex with atp-gamma-s
37% identity, 74% coverage: 8:257/337 of query aligns to 3:241/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
37% identity, 74% coverage: 8:257/337 of query aligns to 3:241/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
37% identity, 74% coverage: 8:257/337 of query aligns to 3:241/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
37% identity, 74% coverage: 8:257/337 of query aligns to 3:241/242 of 2oljA
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
37% identity, 74% coverage: 8:257/337 of query aligns to 2:239/241 of 4u00A
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
35% identity, 74% coverage: 8:257/337 of query aligns to 1:239/240 of 4ymuJ
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
33% identity, 73% coverage: 21:265/337 of query aligns to 18:252/343 of P30750
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
32% identity, 73% coverage: 21:265/337 of query aligns to 19:253/344 of 6cvlD
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
32% identity, 73% coverage: 21:265/337 of query aligns to 19:253/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
32% identity, 73% coverage: 21:265/337 of query aligns to 19:253/344 of 3tuiC
Sites not aligning to the query:
7z15I E. Coli c-p lyase bound to a phnk/phnl dual abc dimer and adp + pi (see paper)
34% identity, 69% coverage: 27:257/337 of query aligns to 22:247/253 of 7z15I
Sites not aligning to the query:
7z18I E. Coli c-p lyase bound to a phnk abc dimer and atp (see paper)
34% identity, 69% coverage: 27:257/337 of query aligns to 22:247/250 of 7z18I
Sites not aligning to the query:
7z16I E. Coli c-p lyase bound to phnk/phnl dual abc dimer with amppnp and phnk e171q mutation (see paper)
33% identity, 69% coverage: 27:257/337 of query aligns to 22:247/250 of 7z16I
Sites not aligning to the query:
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
31% identity, 77% coverage: 8:266/337 of query aligns to 17:268/378 of P69874
Sites not aligning to the query:
P02915 Histidine/lysine/arginine/ornithine transport ATP-binding protein HisP; EC 7.4.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
35% identity, 70% coverage: 13:248/337 of query aligns to 11:247/258 of P02915
1b0uA Atp-binding subunit of the histidine permease from salmonella typhimurium (see paper)
35% identity, 70% coverage: 13:248/337 of query aligns to 7:243/258 of 1b0uA
2pclA Crystal structure of abc transporter with complex (aq_297) from aquifex aeolicus vf5
33% identity, 66% coverage: 13:235/337 of query aligns to 8:219/223 of 2pclA
>SMc03125 FitnessBrowser__Smeli:SMc03125
MGAAKPDLVALRDLKVAFDGVQVLHGIDLNVAKGEAVGLVGESGCGKSVTWLAALGLLPG
KAAVTGSVRIDGRELCGARRTALEEVRGGRIAMIFQDPSSSLNPVLRIGRQIVEALYIHR
GLRGDAARVEALRLMDMVGIPDAARRFDLYPHEFSGGQCQRLMIAMALAGEPDLLIADEP
TTALDATIQAQILDLLNTLRAETGMALVFISHDLGAVSQVCDRVCVMYAGRIVEEGSVAQ
LFSEPRHPYTRGLFDAIPRIDGPRDRLIPIPGTVPNPKHLPAGCSFSPRCPRAVDACGSD
YPHLEPQGDGRRLACMRPVPAVTRGDAERRVPEGLMS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory