SitesBLAST
Comparing SMc03160 FitnessBrowser__Smeli:SMc03160 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6rjmB Complex structure of virulence factor sgha and its hydrolysis product glucose (see paper)
78% identity, 98% coverage: 6:455/458 of query aligns to 4:453/456 of 6rjmB
- binding alpha-D-glucopyranose: Q24 (= Q26), H125 (= H127), N169 (= N171), E170 (= E172), Y298 (= Y300), W331 (= W333), E358 (= E360), W404 (= W406), E411 (= E413), W412 (= W414), F420 (= F422)
6rk2A Complex structure of virulence factor sgha mutant with its substrate sag (see paper)
77% identity, 98% coverage: 2:452/458 of query aligns to 4:454/454 of 6rk2A
6rjoA Complex structure of virulence factor sgha with its substrate analog salicin (see paper)
77% identity, 98% coverage: 2:452/458 of query aligns to 4:454/454 of 6rjoA
P12614 Beta-glucosidase; Amygdalase; Beta-D-glucoside glucohydrolase; Cellobiase; Gentiobiase; EC 3.2.1.21 from Agrobacterium sp. (strain ATCC 21400)
75% identity, 99% coverage: 2:455/458 of query aligns to 1:454/459 of P12614
- E359 (= E360) active site, Nucleophile
5ns8A Crystal structure of beta-glucosidase bglm-g1 mutant h75r from marine metagenome in complex with inhibitor 1-deoxynojirimycin (see paper)
49% identity, 94% coverage: 16:444/458 of query aligns to 9:434/440 of 5ns8A
6z1mA Structure of an ancestral glycosidase (family 1) bound to heme (see paper)
49% identity, 95% coverage: 11:446/458 of query aligns to 2:417/423 of 6z1mA
- binding protoporphyrin ix containing fe: P164 (= P173), N165 (≠ W174), L194 (≠ T203), L195 (≠ N204), L218 (≠ I227), L220 (≠ A229), N244 (≠ H252), F247 (= F256), K253 (= K262), Y256 (= Y265), L288 (= L292), R318 (≠ T346), Y323 (= Y351)
- binding magnesium ion: H346 (≠ D375), K409 (= K438)
2jalB Beta-glucosidase from thermotoga maritima in complex with cyclophellitol (see paper)
46% identity, 96% coverage: 9:448/458 of query aligns to 2:439/444 of 2jalB
- active site: R76 (= R83), H120 (= H127), E165 (= E172), V168 (≠ C175), N292 (= N298), Y294 (= Y300), E350 (= E360)
- binding calcium ion: D277 (≠ G283), E281 (≠ T287)
- binding (1r,2s,3s,4s,5r,6r)-6-(hydroxymethyl)cyclohexane-1,2,3,4,5-pentol: Q19 (= Q26), H120 (= H127), E165 (= E172), E350 (= E360), W397 (= W406), E404 (= E413), W405 (= W414), F413 (= F422)
5ossB Beta-glucosidase from thermotoga maritima in complex with gluco-1h- imidazole (see paper)
46% identity, 96% coverage: 9:448/458 of query aligns to 1:438/443 of 5ossB
- active site: R75 (= R83), H119 (= H127), E164 (= E172), V167 (≠ C175), N291 (= N298), Y293 (= Y300), E349 (= E360)
- binding (4~{S},5~{S},6~{R},7~{R})-7-(hydroxymethyl)-4,5,6,7-tetrahydro-1~{H}-benzimidazole-4,5,6-triol: Q18 (= Q26), H119 (= H127), E164 (= E172), Y293 (= Y300), E349 (= E360), W396 (= W406), E403 (= E413), W404 (= W414), F412 (= F422)
5n6tA Thermotoga maritima family 1 glycoside hydrolase complexed with a cyclophellitol analogue transition state mimic (see paper)
46% identity, 96% coverage: 9:448/458 of query aligns to 1:438/443 of 5n6tA
- active site: R75 (= R83), H119 (= H127), E164 (= E172), V167 (≠ C175), N291 (= N298), Y293 (= Y300), E349 (= E360)
- binding [(1~{R},2~{R},3~{R},4~{S},5~{R},6~{S})-3,4,5-tris(oxidanyl)-7-oxabicyclo[4.1.0]heptan-2-yl]methanediazonium: Q18 (= Q26), H119 (= H127), N163 (= N171), E164 (= E172), Y293 (= Y300), E349 (= E360), W396 (= W406), E403 (= E413), W404 (= W414), F412 (= F422)
5n6sA Thermotoga maritima family 1 glycoside hydrolase complexed with carba- cyclophellitol transition state mimic (see paper)
46% identity, 96% coverage: 9:448/458 of query aligns to 1:438/443 of 5n6sA
- active site: R75 (= R83), H119 (= H127), E164 (= E172), V167 (≠ C175), N291 (= N298), Y293 (= Y300), E349 (= E360)
- binding azanylidene-[4-[[(1~{S},2~{R},3~{R},4~{R},5~{S},6~{S},7~{S})-2-(hydroxymethyl)-3,4,5-tris(oxidanyl)-7-bicyclo[4.1.0]heptanyl]carbonylamino]butylimino]azanium: Q18 (= Q26), H119 (= H127), W120 (= W128), N163 (= N171), E164 (= E172), W166 (= W174), V167 (≠ C175), E349 (= E360), W396 (= W406), E403 (= E413), W404 (= W414), F412 (= F422)
2wc4A Structure of family 1 beta-glucosidase from thermotoga maritima in complex with 3-imino-2-thia-(+)-castanospermine (see paper)
46% identity, 96% coverage: 9:448/458 of query aligns to 1:438/443 of 2wc4A
- active site: R75 (= R83), H119 (= H127), E164 (= E172), V167 (≠ C175), N291 (= N298), Y293 (= Y300), E349 (= E360)
- binding (3Z,5S,6R,7S,8R,8aS)-3-(octylimino)hexahydro[1,3]thiazolo[3,4-a]pyridine-5,6,7,8-tetrol: Q18 (= Q26), H119 (= H127), N163 (= N171), E164 (= E172), Y293 (= Y300), W322 (= W333), E349 (= E360), W396 (= W406), E403 (= E413), W404 (= W414), F412 (= F422)
2wbgA Structure of family 1 beta-glucosidase from thermotoga maritima in complex with 3-imino-2-oxa-(+)-castanospermine (see paper)
46% identity, 96% coverage: 9:448/458 of query aligns to 1:438/443 of 2wbgA
- active site: R75 (= R83), H119 (= H127), E164 (= E172), V167 (≠ C175), N291 (= N298), Y293 (= Y300), E349 (= E360)
- binding (3Z,5S,6R,7S,8R,8aR)-3-(octylimino)hexahydro[1,3]oxazolo[3,4-a]pyridine-5,6,7,8-tetrol: Q18 (= Q26), H119 (= H127), N163 (= N171), E164 (= E172), Y293 (= Y300), H296 (≠ M303), W322 (= W333), E349 (= E360), W396 (= W406), E403 (= E413), W404 (= W414)
1oinA Family 1 b-glucosidase from thermotoga maritima (see paper)
46% identity, 96% coverage: 9:448/458 of query aligns to 2:437/442 of 1oinA
- active site: R76 (= R83), H120 (= H127), E165 (= E172), V168 (≠ C175), N292 (= N298), Y294 (= Y300), E348 (= E360)
- binding 2-deoxy-2-fluoro-alpha-D-glucopyranose: Q19 (= Q26), H120 (= H127), N164 (= N171), E165 (= E172), Y294 (= Y300), E348 (= E360), W395 (= W406), E402 (= E413), W403 (= W414)
1oifA Family 1 b-glucosidase from thermotoga maritima (see paper)
46% identity, 96% coverage: 9:448/458 of query aligns to 1:438/444 of 1oifA
- active site: R75 (= R83), H119 (= H127), E164 (= E172), V167 (≠ C175), N291 (= N298), Y293 (= Y300), E349 (= E360)
- binding 5-hydroxymethyl-3,4-dihydroxypiperidine: Q18 (= Q26), E164 (= E172), Y293 (= Y300), E349 (= E360), W396 (= W406), E403 (= E413), W404 (= W414), F412 (= F422)
1w3jA Family 1 b-glucosidase from thermotoga maritima in complex with tetrahydrooxazine (see paper)
46% identity, 96% coverage: 11:448/458 of query aligns to 2:437/443 of 1w3jA
- active site: R74 (= R83), H118 (= H127), E163 (= E172), V166 (≠ C175), N290 (= N298), Y292 (= Y300), E348 (= E360)
- binding tetrahydrooxazine: Q17 (= Q26), H118 (= H127), E163 (= E172), Y292 (= Y300), E348 (= E360), W395 (= W406), E402 (= E413), W403 (= W414)
2cesA Beta-glucosidase from thermotoga maritima in complex with glucoimidazole (see paper)
46% identity, 96% coverage: 9:448/458 of query aligns to 1:435/440 of 2cesA
- active site: R75 (= R83), H119 (= H127), E164 (= E172), V167 (≠ C175), N291 (= N298), Y293 (= Y300), E346 (= E360)
- binding glucoimidazole: Q18 (= Q26), H119 (= H127), N163 (= N171), E164 (= E172), Y293 (= Y300), E346 (= E360), W393 (= W406), E400 (= E413), W401 (= W414), F409 (= F422)
1e4iA 2-deoxy-2-fluoro-beta-d-glucosyl/enzyme intermediate complex of the beta-glucosidase from bacillus polymyxa (see paper)
46% identity, 95% coverage: 11:447/458 of query aligns to 4:438/447 of 1e4iA
- active site: R76 (= R83), H120 (= H127), E165 (= E172), C168 (= C175), N293 (= N298), Y295 (= Y300), E351 (= E360)
- binding 2-deoxy-2-fluoro-alpha-D-glucopyranose: Q19 (= Q26), H120 (= H127), N164 (= N171), E165 (= E172), Y295 (= Y300), E351 (= E360), W397 (= W406), E404 (= E413), W405 (= W414)
- binding 2,4-dinitrophenyl 2-deoxy-2-fluoro-beta-D-glucopyranoside: R136 (= R143), Q140 (≠ Y147), V143 (≠ Q150), L202 (= L209)
6r4kA Structure of beta-glucosidase a from paenibacillus polymyxa complexed with a monovalent inhibitor (see paper)
46% identity, 95% coverage: 11:447/458 of query aligns to 5:439/448 of 6r4kA
- binding (2~{S},3~{S},4~{R})-2-[[4-[4-[2-[2-(2-azanylidenehydrazinyl)ethoxy]ethoxy]phenyl]-1,2,3-triazol-1-yl]methyl]pyrrolidine-3,4-diol: Q20 (= Q26), H121 (= H127), E166 (= E172), L173 (= L179), E352 (= E360), W398 (= W406), E405 (= E413), W406 (= W414)
6qwiA Structure of beta-glucosidase a from paenibacillus polymyxa complexed with multivalent inhibitors. (see paper)
46% identity, 95% coverage: 11:447/458 of query aligns to 5:439/448 of 6qwiA
- binding (2~{S},3~{S},4~{R})-2-[[4-[4-(2-ethoxyethoxy)phenyl]-1,2,3-triazol-1-yl]methyl]pyrrolidine-3,4-diol: Q20 (= Q26), H121 (= H127), W122 (= W128), E166 (= E172), L173 (= L179), W326 (= W333), E352 (= E360), W398 (= W406), E405 (= E413), W406 (= W414)
2wc3A Structure of family 1 beta-glucosidase from thermotoga maritima in complex with 3-imino-2-oxa-(+)-8-epi-castanospermine (see paper)
45% identity, 96% coverage: 9:448/458 of query aligns to 2:437/442 of 2wc3A
- active site: R76 (= R83), H120 (= H127), E165 (= E172), V168 (≠ C175), N292 (= N298), Y294 (= Y300), E348 (= E360)
- binding (3Z,5S,6R,7S,8S,8aR)-3-(octylimino)hexahydro[1,3]oxazolo[3,4-a]pyridine-5,6,7,8-tetrol: Q19 (= Q26), H120 (= H127), N164 (= N171), E165 (= E172), Y294 (= Y300), H297 (≠ M303), W321 (= W333), E348 (= E360), W395 (= W406), E402 (= E413), W403 (= W414), F411 (= F422)
Query Sequence
>SMc03160 FitnessBrowser__Smeli:SMc03160
MMIEAKKLAARFPGDFVFGVATASFQIEGASKADGRKASIWDAFSNMPGRVYGRHNGDVA
CDHYNRLEQDLDLIKSLGVEAYRFSIAWPRIVPEGTGPINEKGLDFYDRLVDGLKARGIK
AFATLYHWDLPLALMGDGGWTARTTAYAYQRYAKTVIARLGDRLDAVATFNEPWCSVWLG
HLYGVHAPGERNMDAALAALHFTNLAHGLGVAAIRSERPELPVGIVINAHSVYPGSNSAE
DKAAAERAFDFHNGVFFDPIFKGEYPEDFLSALGERMPAIEDGDMATIAQPLDWWGLNYY
TPMRVSADPAKGAEYPATVNAKPVSNVKTDIGWEVYAPALGSLVETLNARYRLPDCYITE
NGACYNMGVENGTVDDQPRLDYISDHLAVTADLIAKGYPMRGYFAWSLMDNFEWAEGYRM
RFGIVHVDYETQVRTIKKSGRWYKDLAERFPSGNHKPG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory