Comparing SMc03164 FitnessBrowser__Smeli:SMc03164 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P09099 Xylulose kinase; XK; Xylulokinase; 1-deoxy-D-xylulokinase; EC 2.7.1.17; EC 2.7.1.- from Escherichia coli (strain K12) (see paper)
49% identity, 98% coverage: 1:476/484 of query aligns to 1:476/484 of P09099
2itmA Crystal structure of the e. Coli xylulose kinase complexed with xylulose (see paper)
47% identity, 98% coverage: 1:476/484 of query aligns to 1:468/476 of 2itmA
3i8bA The crystal structure of xylulose kinase from bifidobacterium adolescentis
28% identity, 97% coverage: 1:468/484 of query aligns to 5:504/506 of 3i8bA
3kzbA Crystal structure of xylulokinase from chromobacterium violaceum
29% identity, 89% coverage: 5:435/484 of query aligns to 9:449/498 of 3kzbA
3ll3A The crystal structure of ligand bound xylulose kinase from lactobacillus acidophilus
26% identity, 99% coverage: 3:482/484 of query aligns to 6:483/492 of 3ll3A
3ll3B The crystal structure of ligand bound xylulose kinase from lactobacillus acidophilus
25% identity, 99% coverage: 3:482/484 of query aligns to 5:481/490 of 3ll3B
6k76A Glycerol kinase form thermococcus kodakarensis, complex structure with substrate.
26% identity, 99% coverage: 3:483/484 of query aligns to 2:474/485 of 6k76A
P18157 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Bacillus subtilis (strain 168) (see paper)
23% identity, 90% coverage: 3:437/484 of query aligns to 6:450/496 of P18157
6jafA Crystal structure of trypanosoma brucei gambiense glycerol kinase complex with ppi (pyrophosphatase reaction)
24% identity, 86% coverage: 2:419/484 of query aligns to 5:447/513 of 6jafA
6j9qA Crystal structure of trypanosoma brucei gambiense glycerol kinase complex with amp-pnp.
24% identity, 86% coverage: 2:419/484 of query aligns to 5:447/513 of 6j9qA
5aziA Crystal structure of glycerol kinase from trypanosoma brucei gambiense complexed with 4np (see paper)
24% identity, 86% coverage: 2:419/484 of query aligns to 5:447/513 of 5aziA
3wxlA Crystal structure of trypanosoma brucei gambiense glycerol kinase complex with adp, mg2+, and glycerol (see paper)
24% identity, 86% coverage: 2:419/484 of query aligns to 5:447/513 of 3wxlA
3wxjB Crystal structure of trypanosoma brucei gambiense glycerol kinase in complex with glycerol 3-phosphate (see paper)
24% identity, 86% coverage: 2:419/484 of query aligns to 5:447/513 of 3wxjB
Q9NJP9 Glycerol kinase, glycosomal; GK; Glycerokinase; ATP:glycerol 3-phosphotransferase; EC 2.7.1.30 from Trypanosoma brucei brucei (see 2 papers)
24% identity, 86% coverage: 2:419/484 of query aligns to 3:445/512 of Q9NJP9
5gn6A Crystal structure of glycerol kinase from trypanosoma brucei gambiense complexed with cumarin derivative-17b (see paper)
24% identity, 86% coverage: 2:419/484 of query aligns to 5:447/513 of 5gn6A
5gn5A Crystal structure of glycerol kinase from trypanosoma brucei gambiense complexed with cumarin derivative-17 (see paper)
24% identity, 86% coverage: 2:419/484 of query aligns to 5:447/513 of 5gn5A
O86033 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)
24% identity, 86% coverage: 3:418/484 of query aligns to 6:433/497 of O86033
4bc2A Crystal structure of human d-xylulokinase in complex with d-xylulose and adenosine diphosphate (see paper)
25% identity, 97% coverage: 3:471/484 of query aligns to 7:522/528 of 4bc2A
4bc5A Crystal structure of human d-xylulokinase in complex with inhibitor 5-deoxy-5-fluoro-d-xylulose (see paper)
25% identity, 97% coverage: 3:471/484 of query aligns to 5:520/524 of 4bc5A
2w41B Crystal structure of plasmodium falciparum glycerol kinase with adp (see paper)
21% identity, 89% coverage: 3:432/484 of query aligns to 11:455/507 of 2w41B
>SMc03164 FitnessBrowser__Smeli:SMc03164
MYLGLDLGTSGVKAMLMDGEQRIIGSASGALDVDRPHPGWSEQDPADWIRAAEEAIARLR
ETHAQALAAVRGIGLSGQMHGATLLDEGDAVLRPCILWNDTRSFREAAALDGDPQFRALT
GNIVFPGFTAPKLAWVRENEPEIFARVRWVLLPKDYLRLWLTGEHMSEMSDSAGTSWLDT
GKRKWSASLLAATHLEERQMPDLVEGTDAAGTLRPELAARWGMGPGVVVAGGAGDNAASA
CGMGTVGEGQAFVSLGTSGVLFAANASYLPNPESAVHAFCHALPNTWHQMGVILSATDAL
NWHSGVTGRSAAELTSELGESLKAPGSVTFLPYLSGERTPHNDATIRGVFAGLGHESSRA
VLTQAVLEGVSFAIRDSLEALRAAGTKLKRVTAIGGGSRSRYWLSSIATALNLPVDLPAD
GDFGAAFGAARLGLIAATGADPAAVCTAPETAETIAPEASLVPAYEDAYQRYRRLYPAIK
EAAL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory