Comparing SMc03165 FitnessBrowser__Smeli:SMc03165 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 19 hits to proteins with known functional sites (download)
2h3hA Crystal structure of the liganded form of thermotoga maritima glucose binding protein (see paper)
32% identity, 52% coverage: 123:301/345 of query aligns to 60:236/313 of 2h3hA
Sites not aligning to the query:
3c6qC Apo and ligand-bound form of a thermophilic glucose/xylose binding protein
32% identity, 52% coverage: 123:301/345 of query aligns to 60:236/305 of 3c6qC
Sites not aligning to the query:
5hqjA Crystal structure of abc transporter solute binding protein b1g1h7 from burkholderia graminis c4d1m, target efi-511179, in complex with d-arabinose
30% identity, 55% coverage: 113:301/345 of query aligns to 55:245/289 of 5hqjA
Sites not aligning to the query:
7x0hA Crystal structure of sugar binding protein cbpa complexed wtih glucose from clostridium thermocellum (see paper)
25% identity, 63% coverage: 105:321/345 of query aligns to 49:261/287 of 7x0hA
Sites not aligning to the query:
5xssA Xylfii molecule (see paper)
24% identity, 62% coverage: 81:295/345 of query aligns to 20:238/274 of 5xssA
Sites not aligning to the query:
6gt9A Crystal structure of ganp, a glucose-galactose binding protein from geobacillus stearothermophilus, in complex with galactose
24% identity, 64% coverage: 123:342/345 of query aligns to 66:283/283 of 6gt9A
Sites not aligning to the query:
6guqA Crystal structure of ganp, a glucose-galactose binding protein from geobacillus stearothermophilus, in complex with glucose
24% identity, 64% coverage: 123:342/345 of query aligns to 61:278/278 of 6guqA
Sites not aligning to the query:
1rzrG Crystal structure of transcriptional regulator- phosphoprotein-DNA complex (see paper)
41% identity, 23% coverage: 1:79/345 of query aligns to 1:83/332 of 1rzrG
1rzrA Crystal structure of transcriptional regulator- phosphoprotein-DNA complex (see paper)
41% identity, 23% coverage: 1:79/345 of query aligns to 1:83/332 of 1rzrA
Sites not aligning to the query:
3oqoA Ccpa-hpr-ser46p-syn cre (see paper)
41% identity, 23% coverage: 1:79/345 of query aligns to 1:83/333 of 3oqoA
1lbgA Lactose operon repressor bound to 21-base pair symmetric operator DNA, alpha carbons only (see paper)
25% identity, 66% coverage: 1:227/345 of query aligns to 1:215/357 of 1lbgA
2pe5A Crystal structure of the lac repressor bound to onpg in repressed state (see paper)
26% identity, 65% coverage: 4:227/345 of query aligns to 4:214/328 of 2pe5A
Sites not aligning to the query:
1efaA Crystal structure of the lac repressor dimer bound to operator and the anti-inducer onpf (see paper)
25% identity, 65% coverage: 4:227/345 of query aligns to 4:214/328 of 1efaA
Sites not aligning to the query:
2jcgA Apo form of the catabolite control protein a (ccpa) from bacillus megaterium, with the DNA binding domain (see paper)
53% identity, 12% coverage: 4:46/345 of query aligns to 2:44/322 of 2jcgA
Sites not aligning to the query:
2pubA Crystal structure of the laci family member, purr, bound to dna: minor groove binding by alpha helices (see paper)
26% identity, 61% coverage: 4:215/345 of query aligns to 1:204/338 of 2pubA
Sites not aligning to the query:
2puaA Crystal structure of the laci family member, purr, bound to dna: minor groove binding by alpha helices (see paper)
26% identity, 61% coverage: 4:215/345 of query aligns to 2:205/339 of 2puaA
Sites not aligning to the query:
1wetA Structure of the purr-guanine-purf operator complex (see paper)
26% identity, 61% coverage: 4:215/345 of query aligns to 1:204/338 of 1wetA
Sites not aligning to the query:
P0ACP7 HTH-type transcriptional repressor PurR; Pur regulon repressor; Purine nucleotide synthesis repressor from Escherichia coli (strain K12) (see 5 papers)
26% identity, 61% coverage: 4:215/345 of query aligns to 3:206/341 of P0ACP7
Sites not aligning to the query:
1jftA Purine repressor mutant-hypoxanthine-purf operator complex (see paper)
26% identity, 61% coverage: 4:215/345 of query aligns to 2:205/340 of 1jftA
Sites not aligning to the query:
>SMc03165 FitnessBrowser__Smeli:SMc03165
MRPTVHDIAAEAGVSLATVDRVLNNRPGVRSVTRGKVERAIATLGYVRDVAAANLAKSRS
YPLIFILPAGENSFMRGLEAEVRSAMSRSATERLDITILSVPVFDAPALAAALHDARERR
PAGVAVVAVDAPEVTEAVKRLREDGIAVVTLVSDLPGSGRDHFAGVDNVAAGRTAGSLMG
RFLGGGEGPVAVLAGSMLVRDHRDRLEGFQAVMSEDFAWRRILPVIEGQDNPSLVETLVG
ALLGQHPDLAGIYSLGAGNRGLVAALEKAGKGRAVCTIAHELTPHSRAGLLSGTIDALLN
QNAGHEVRSAIRVLKAKADGLPVIAAQERIRIDIFLKDNLPLEQE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory