SitesBLAST
Comparing SMc03172 FitnessBrowser__Smeli:SMc03172 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8vc5A Crystal structure of glutamyl-tRNA synthetase glurs from pseudomonas aeruginosa (zinc bound)
51% identity, 98% coverage: 4:478/485 of query aligns to 2:470/488 of 8vc5A
2cv2A Glutamyl-tRNA synthetase from thermus thermophilus in complex with tRNA(glu) and an enzyme inhibitor, glu-ams (see paper)
45% identity, 96% coverage: 6:473/485 of query aligns to 2:466/468 of 2cv2A
- active site: K246 (= K256)
- binding o5'-(l-glutamyl-sulfamoyl)-adenosine: R5 (= R9), A7 (= A11), S9 (= S13), G17 (= G21), I21 (= I25), E41 (= E45), Y187 (= Y197), R205 (= R215), A206 (≠ G216), E208 (= E218), W209 (= W219), L235 (= L245), L236 (≠ M246)
- binding : S9 (= S13), T43 (= T47), D44 (= D48), R47 (= R51), V145 (= V155), R163 (≠ Y173), Y168 (≠ I178), E172 (≠ A182), V177 (= V187), K180 (= K190), S181 (≠ A191), Y187 (= Y197), E207 (= E217), E208 (= E218), W209 (= W219), V211 (≠ A221), R237 (= R247), K241 (= K251), L272 (= L282), M273 (≠ F283), G274 (≠ F284), E282 (= E292), S299 (= S309), P303 (≠ A313), V304 (≠ I314), K309 (= K319), W312 (= W322), R319 (= R329), P357 (≠ T360), R358 (= R361), R417 (= R424), Q432 (≠ A439), R435 (≠ F442), L442 (≠ Q449), E443 (≠ R450), T444 (≠ S451), G446 (≠ P453), L447 (= L454), F448 (= F455)
2cv1A Glutamyl-tRNA synthetase from thermus thermophilus in complex with tRNA(glu), atp, and an analog of l-glutamate: a quaternary complex
45% identity, 96% coverage: 6:473/485 of query aligns to 2:466/468 of 2cv1A
- active site: K246 (= K256)
- binding adenosine-5'-triphosphate: P8 (= P12), S9 (= S13), G17 (= G21), T18 (= T22), I21 (= I25), R47 (= R51), A206 (≠ G216), W209 (= W219), L235 (= L245), L236 (≠ M246)
- binding (4s)-4-amino-5-hydroxypentanoic acid: R5 (= R9), A7 (= A11), E41 (= E45), Y187 (= Y197), R205 (= R215), W209 (= W219)
- binding : S9 (= S13), E41 (= E45), T43 (= T47), D44 (= D48), R47 (= R51), V145 (= V155), R163 (≠ Y173), V166 (= V176), E172 (≠ A182), V177 (= V187), K180 (= K190), S181 (≠ A191), Y187 (= Y197), E207 (= E217), E208 (= E218), W209 (= W219), V211 (≠ A221), R237 (= R247), K241 (= K251), K243 (= K253), M273 (≠ F283), G274 (≠ F284), S276 (≠ Q286), E282 (= E292), S299 (= S309), P303 (≠ A313), V304 (≠ I314), K309 (= K319), W312 (= W322), R319 (= R329), P357 (≠ T360), R358 (= R361), R417 (= R424), L427 (= L434), Q432 (≠ A439), R435 (≠ F442), L442 (≠ Q449), E443 (≠ R450), T444 (≠ S451), G446 (≠ P453), L447 (= L454), F448 (= F455)
2cuzA Glutamyl-tRNA synthetase from thermus thermophilus in complex with l-glutamate (see paper)
45% identity, 96% coverage: 6:473/485 of query aligns to 2:466/468 of 2cuzA
1n78A Crystal structure of thermus thermophilus glutamyl-tRNA synthetase complexed with tRNA(glu) and glutamol-amp. (see paper)
45% identity, 96% coverage: 6:473/485 of query aligns to 2:466/468 of 1n78A
- active site: K246 (= K256)
- binding glutamol-amp: R5 (= R9), A7 (= A11), P8 (= P12), S9 (= S13), G17 (= G21), T18 (= T22), I21 (= I25), E41 (= E45), Y187 (= Y197), N191 (= N201), R205 (= R215), A206 (≠ G216), E208 (= E218), W209 (= W219), L235 (= L245), L236 (≠ M246)
- binding : S9 (= S13), T43 (= T47), D44 (= D48), R47 (= R51), V145 (= V155), R163 (≠ Y173), V166 (= V176), Y168 (≠ I178), E172 (≠ A182), V177 (= V187), K180 (= K190), S181 (≠ A191), Y187 (= Y197), E207 (= E217), E208 (= E218), W209 (= W219), L210 (= L220), V211 (≠ A221), R237 (= R247), K241 (= K251), M273 (≠ F283), G274 (≠ F284), E282 (= E292), R297 (≠ N307), P303 (≠ A313), V304 (≠ I314), K309 (= K319), W312 (= W322), R319 (= R329), P357 (≠ T360), R358 (= R361), R417 (= R424), L427 (= L434), Q432 (≠ A439), R435 (≠ F442), L442 (≠ Q449), E443 (≠ R450), T444 (≠ S451), G446 (≠ P453), L447 (= L454), F448 (= F455)
1j09A Crystal structure of thermus thermophilus glutamyl-tRNA synthetase complexed with atp and glu (see paper)
45% identity, 96% coverage: 6:473/485 of query aligns to 2:466/468 of 1j09A
- active site: K246 (= K256)
- binding adenosine-5'-triphosphate: H15 (= H19), E208 (= E218), L235 (= L245), L236 (≠ M246), K243 (= K253), I244 (≠ L254), S245 (= S255), K246 (= K256), R247 (= R257)
- binding glutamic acid: R5 (= R9), A7 (= A11), S9 (= S13), E41 (= E45), Y187 (= Y197), N191 (= N201), R205 (= R215), W209 (= W219)
P27000 Glutamate--tRNA ligase; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
45% identity, 96% coverage: 6:473/485 of query aligns to 2:466/468 of P27000
- R358 (= R361) mutation to Q: Reduces affinity for tRNA and abolishes the ability to discriminate between tRNA(Glu) and tRNA(Gln).
1g59A Glutamyl-tRNA synthetase complexed with tRNA(glu). (see paper)
45% identity, 96% coverage: 6:473/485 of query aligns to 2:466/468 of 1g59A
- binding : D44 (= D48), R45 (≠ A49), A46 (≠ T50), R47 (= R51), P109 (= P113), V145 (= V155), R163 (≠ Y173), V166 (= V176), E172 (≠ A182), V177 (= V187), K180 (= K190), S181 (≠ A191), D182 (= D192), E207 (= E217), E208 (= E218), R237 (= R247), K241 (= K251), T242 (≠ S252), K243 (= K253), M273 (≠ F283), G274 (≠ F284), E282 (= E292), S299 (= S309), L300 (≠ K310), P303 (≠ A313), V304 (≠ I314), K309 (= K319), W312 (= W322), R319 (= R329), P357 (≠ T360), R358 (= R361), R417 (= R424), K426 (= K433), L427 (= L434), Q432 (≠ A439), R435 (≠ F442), L442 (≠ Q449), E443 (≠ R450), T444 (≠ S451), P445 (≠ L452), G446 (≠ P453), L447 (= L454), F448 (= F455)
4griB Crystal structure of a glutamyl-tRNA synthetase glurs from borrelia burgdorferi bound to glutamic acid and zinc (see paper)
40% identity, 98% coverage: 5:477/485 of query aligns to 1:482/485 of 4griB
- active site: S9 (= S13), K253 (= K256)
- binding glutamic acid: R5 (= R9), A7 (= A11), S9 (= S13), E41 (= E45), Y194 (= Y197), R212 (= R215), W216 (= W219)
- binding zinc ion: C105 (= C109), C107 (= C111), Y128 (= Y132), C132 (= C136)
3al0C Crystal structure of the glutamine transamidosome from thermotoga maritima in the glutamylation state. (see paper)
36% identity, 97% coverage: 6:477/485 of query aligns to 103:562/564 of 3al0C
- active site: S110 (= S13), K335 (= K256)
- binding o5'-(l-glutamyl-sulfamoyl)-adenosine: R106 (= R9), A108 (= A11), P109 (= P12), G118 (= G21), T122 (≠ I25), E142 (= E45), Y276 (= Y197), R294 (= R215), G295 (= G216), D297 (≠ E218), H298 (≠ W219), L324 (= L245), I325 (≠ M246), L333 (= L254)
- binding : T144 (= T47), D145 (= D48), R148 (= R51), Y208 (≠ P113), P213 (≠ Q118), K252 (≠ Y173), M255 (≠ V176), I266 (≠ V187), K269 (= K190), S270 (≠ A191), Y276 (= Y197), D297 (≠ E218), H298 (≠ W219), L299 (= L220), S300 (≠ A221), N301 (≠ S222), K304 (= K225), R330 (≠ K251), P332 (≠ K253), G363 (≠ F284), W364 (≠ I285), R365 (≠ Q286), E370 (= E292), S387 (= S309), K389 (≠ A311), V391 (≠ A313), I392 (= I314), K397 (= K319), W400 (= W322), R407 (= R329), E446 (≠ T360), K447 (≠ R361), Q453 (≠ E367), I457 (≠ L371), R509 (= R424), K520 (= K435), Q524 (≠ A439), R527 (≠ F442), V535 (≠ R450), T536 (≠ S451), G538 (≠ P453), L539 (= L454)
2cfoA Non-discriminating glutamyl-tRNA synthetase from thermosynechococcus elongatus in complex with glu (see paper)
38% identity, 91% coverage: 6:447/485 of query aligns to 2:453/484 of 2cfoA
Q8DLI5 Glutamate--tRNA ligase; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1) (see paper)
38% identity, 91% coverage: 6:447/485 of query aligns to 3:454/485 of Q8DLI5
- R6 (= R9) binding
- Y192 (= Y197) binding
P04805 Glutamate--tRNA ligase; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Escherichia coli (strain K12) (see 4 papers)
35% identity, 98% coverage: 6:478/485 of query aligns to 3:465/471 of P04805
- C98 (= C109) mutation to S: 10-fold decrease in activity. Strong decrease in zinc content.
- C100 (= C111) mutation to S: Loss of activity. Strong decrease in zinc content.; mutation to Y: Does not prevent zinc binding. Reduces only 2-fold the binding affinity for tRNA(Glu), but reduces more than 10-fold the affinity for glutamate in the presence of tRNA(Glu).
- C125 (= C136) mutation to S: Loss of activity. Strong decrease in zinc content.
- H127 (≠ S138) mutation to Q: 10-fold decrease in activity. Strong decrease in zinc content.
- H129 (≠ S140) mutation to Q: No change in activity or in zinc content.
- H131 (≠ E142) mutation to Q: No change in activity or in zinc content.
- H132 (≠ E143) mutation to Q: No change in activity or in zinc content.
- C138 (≠ H154) mutation to S: No change in activity or in zinc content.
- S239 (= S255) modified: Phosphoserine; mutation to D: Does not aminoacylate tRNA(Glu), not phosphorylated by HipA.
6brlA Crystal structure of a glutamate tRNA ligase from elizabethkingia meningosepticum ccug26117 in complex with its amino acid
35% identity, 97% coverage: 6:477/485 of query aligns to 3:501/502 of 6brlA
8i9iA Glutamyl-tRNA synthetase from escherichia coli bound to glutamate and zinc
35% identity, 98% coverage: 6:478/485 of query aligns to 3:465/468 of 8i9iA
4g6zA Crystal structure of a glutamyl-tRNA synthetase glurs from burkholderia thailandensis bound to l-glutamate (see paper)
34% identity, 77% coverage: 6:378/485 of query aligns to 3:355/380 of 4g6zA
3aiiA Archaeal non-discriminating glutamyl-tRNA synthetase from methanothermobacter thermautotrophicus (see paper)
30% identity, 59% coverage: 6:289/485 of query aligns to 11:283/455 of 3aiiA
P27305 Glutamyl-Q tRNA(Asp) synthetase; Glu-Q-RSs; EC 6.1.1.- from Escherichia coli (strain K12) (see paper)
29% identity, 54% coverage: 1:263/485 of query aligns to 11:248/308 of P27305
- E55 (= E45) binding
- Y182 (= Y197) binding
- R200 (= R215) binding
4a91A Crystal structure of the glutamyl-queuosine trnaasp synthetase from e. Coli complexed with l-glutamate (see paper)
30% identity, 51% coverage: 9:257/485 of query aligns to 7:230/290 of 4a91A
- active site: S11 (= S13), K229 (= K256)
- binding glutamic acid: R7 (= R9), A9 (= A11), S11 (= S13), E43 (= E45), Y170 (= Y197), R188 (= R215), L192 (≠ W219)
- binding zinc ion: C99 (= C109), C101 (= C111), Y113 (= Y132), C117 (= C136)
O13775 Probable glutamate--tRNA ligase, cytoplasmic; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
29% identity, 53% coverage: 3:258/485 of query aligns to 204:446/716 of O13775
Sites not aligning to the query:
- 190 modified: Phosphoserine
Query Sequence
>SMc03172 FitnessBrowser__Smeli:SMc03172
MADSAVRVRIAPSPTGEPHVGTAYIALFNYLFAKKHGGKFILRIEDTDATRSTPEFEKKV
LDALKWCGLEWSEGPDIGGPYGPYRQSDRKDIYKPYVEKIVANGHGFRCFCTPERLEQMR
EAQRAAGKPPKYDGLCLSLSAEEVTSRVDAGEPHVVRMKIPTEGSCKFRDGVYGDVEIPW
EAVDMQVLLKADGMPTYHMANVVDDHLMKITHVARGEEWLASVPKHILIYQYLGLEPPVF
MHLSLMRNADKSKLSKRKNPTSISYYTALGYLPEALMNFLGLFFIQIAEGEELLTMEELA
EKFDPENLSKAGAIFDIQKLDWLNARWIREKLSEEEFAARVLAWAMDNERLKEGLKLSQT
RISKLGELPDLAAFLFKSDLGLQPAAFAGVKASPEEMLKILNTVQPDLEKILEWNKDSIE
TELRASAERMGKKLKAVVAPLFVACSGSQRSLPLFDSMELLGRSVVRQRLKVAAQVVASM
AGSGK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory