Comparing SMc03202 FitnessBrowser__Smeli:SMc03202 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1qs0B Crystal structure of pseudomonas putida 2-oxoisovalerate dehydrogenase (branched-chain alpha-keto acid dehydrogenase, e1b) (see paper)
74% identity, 99% coverage: 4:336/337 of query aligns to 5:337/338 of 1qs0B
Q5SLR3 2-oxoisovalerate dehydrogenase subunit beta; Branched-chain alpha-keto acid dehydrogenase E1 component beta chain; BCKDH E1-beta; EC 1.2.4.4 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
52% identity, 100% coverage: 1:336/337 of query aligns to 1:323/324 of Q5SLR3
1umdD Branched-chain 2-oxo acid dehydrogenase (e1) from thermus thermophilus hb8 with 4-methyl-2-oxopentanoate as an intermediate (see paper)
52% identity, 99% coverage: 2:336/337 of query aligns to 1:322/323 of 1umdD
1umcD Branched-chain 2-oxo acid dehydrogenase (e1) from thermus thermophilus hb8 with 4-methylpentanoate (see paper)
52% identity, 99% coverage: 2:336/337 of query aligns to 1:322/323 of 1umcD
1umbD Branched-chain 2-oxo acid dehydrogenase (e1) from thermus thermophilus hb8 in holo-form (see paper)
52% identity, 99% coverage: 2:336/337 of query aligns to 1:322/323 of 1umbD
3dv0D Snapshots of catalysis in the e1 subunit of the pyruvate dehydrogenase multi-enzyme complex (see paper)
50% identity, 93% coverage: 2:316/337 of query aligns to 1:302/324 of 3dv0D
3dv0B Snapshots of catalysis in the e1 subunit of the pyruvate dehydrogenase multi-enzyme complex (see paper)
50% identity, 93% coverage: 2:316/337 of query aligns to 1:302/324 of 3dv0B
3dufD Snapshots of catalysis in the e1 subunit of the pyruvate dehydrogenase multi-enzyme complex (see paper)
50% identity, 93% coverage: 2:316/337 of query aligns to 1:302/324 of 3dufD
1w85B The crystal structure of pyruvate dehydrogenase e1 bound to the peripheral subunit binding domain of e2 (see paper)
50% identity, 93% coverage: 2:316/337 of query aligns to 1:302/324 of 1w85B
1dtwB Human branched-chain alpha-keto acid dehydrogenase (see paper)
47% identity, 99% coverage: 3:336/337 of query aligns to 4:325/326 of 1dtwB
2j9fD Human branched-chain alpha-ketoacid dehydrogenase-decarboxylase e1b (see paper)
47% identity, 99% coverage: 3:336/337 of query aligns to 7:328/329 of 2j9fD
P21953 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial; Branched-chain alpha-keto acid dehydrogenase E1 component beta chain; BCKDE1B; BCKDH E1-beta; EC 1.2.4.4 from Homo sapiens (Human) (see 2 papers)
47% identity, 99% coverage: 3:336/337 of query aligns to 70:391/392 of P21953
6cerD Human pyruvate dehydrogenase complex e1 component v138m mutation (see paper)
40% identity, 93% coverage: 3:316/337 of query aligns to 4:308/331 of 6cerD
6cfoB Human pyruvate dehydrogenase e1 component complex with covalent tdp adduct acetyl phosphinate (see paper)
40% identity, 93% coverage: 3:316/337 of query aligns to 3:307/330 of 6cfoB
P11177 Pyruvate dehydrogenase E1 component subunit beta, mitochondrial; PDHE1-B; EC 1.2.4.1 from Homo sapiens (Human) (see 6 papers)
40% identity, 93% coverage: 3:316/337 of query aligns to 32:336/359 of P11177
Sites not aligning to the query:
8a9cB Structure of truncated 1-deoxy-d-xylulose 5-phosphate synthase (dxs) from klebsiella pneumoniae in complex with cofactor tpp
25% identity, 72% coverage: 52:293/337 of query aligns to 263:477/520 of 8a9cB
Sites not aligning to the query:
8bzxB 1-deoxy-d-xylulose 5-phosphate synthase from klebsiella pneumoniae (kpdxps),co-crystal with thiamine monophosphate analog (see paper)
25% identity, 72% coverage: 52:293/337 of query aligns to 310:524/568 of 8bzxB
Sites not aligning to the query:
8bzxA 1-deoxy-d-xylulose 5-phosphate synthase from klebsiella pneumoniae (kpdxps),co-crystal with thiamine monophosphate analog (see paper)
25% identity, 72% coverage: 52:293/337 of query aligns to 288:502/546 of 8bzxA
Sites not aligning to the query:
2o1sA 1-deoxy-d-xylulose 5-phosphate synthase (dxs) from escherichia coli (see paper)
24% identity, 72% coverage: 52:293/337 of query aligns to 278:492/536 of 2o1sA
Sites not aligning to the query:
2o1sB 1-deoxy-d-xylulose 5-phosphate synthase (dxs) from escherichia coli (see paper)
24% identity, 72% coverage: 52:293/337 of query aligns to 234:448/493 of 2o1sB
Sites not aligning to the query:
>SMc03202 FitnessBrowser__Smeli:SMc03202
MARMTMIEAVRSAMDVSMARDDNVVVFGEDVGYFGGVFRCTQGLQAKYGKTRCFDTPISE
SGIVGTAIGMAAYGLKPCVEIQFADYMYPAYDQLTQEAARIRYRSNGDFTCPIVVRMPTG
GGIFGGQTHSQSPEALFTHVCGLKVVVPSNPYDAKGLLISAIEDPDPVMFLEPKRLYNGP
FDGHHERPVTAWSKHELGDVPDGHYTIPIGKAEIRRKGSGVTVIAYGTMVHVALAAAEET
GIDAEVIDLRSLLPLDLETIVQSAKKTGRCVVVHEATLTSGFGAELAALVQEHCFYHLES
PVVRLTGWDTPYPHAQEWDYFPGPARVGRALAEAMEG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory