Comparing SMc03207 FitnessBrowser__Smeli:SMc03207 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 9 hits to proteins with known functional sites (download)
3lzkC The crystal structure of a probably aromatic amino acid degradation protein from sinorhizobium meliloti 1021
100% identity, 100% coverage: 1:337/338 of query aligns to 7:343/343 of 3lzkC
8gstC Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Pyruvate bound-form) (see paper)
29% identity, 46% coverage: 108:264/338 of query aligns to 93:243/290 of 8gstC
Sites not aligning to the query:
8gsrA Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Apo-form) (see paper)
29% identity, 46% coverage: 108:264/338 of query aligns to 93:243/290 of 8gsrA
6j5xB Crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate (see paper)
27% identity, 61% coverage: 59:264/338 of query aligns to 50:242/280 of 6j5xB
6j5xA Crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate (see paper)
27% identity, 61% coverage: 59:264/338 of query aligns to 50:242/280 of 6j5xA
3r6oA Crystal structure of a probable 2-hydroxyhepta-2,4-diene-1, 7- dioateisomerase from mycobacterium abscessus (see paper)
26% identity, 46% coverage: 109:264/338 of query aligns to 76:226/265 of 3r6oA
8skyB Crystal structure of yisk from bacillus subtilis in complex with oxalate (see paper)
26% identity, 58% coverage: 71:266/338 of query aligns to 85:268/303 of 8skyB
8sutA Crystal structure of yisk from bacillus subtilis in complex with reaction product 4-hydroxy-2-oxoglutaric acid (see paper)
26% identity, 58% coverage: 71:266/338 of query aligns to 86:269/303 of 8sutA
6iymA Fumarylacetoacetate hydrolase (eafah) from psychrophilic exiguobacterium antarcticum (see paper)
25% identity, 64% coverage: 49:264/338 of query aligns to 36:240/277 of 6iymA
>SMc03207 FitnessBrowser__Smeli:SMc03207
MKLATLKDSTRDGKLVVVSKDLTRCSEVGHIARTLQAALDDWAHAGPRLERVAEGIETGA
QPTMRFHEHDAASPLPRAFQWADGSAYVNHVELVRKARNAEMPASFWTDPLIYQGGSDSF
LGPRDPILMADDAWGIDMEGEAAVIVDDVPMGATLDEAKAAIRLVMLVNDVSLRGLIPGE
LAKGFGFYQSKPSSAFSPVAVTPEELGEAWDGGKLHLPLHVDLNGEPFGRANAGIDMTFD
FPQLIVHAARTRPLSAGTIIGSGTVSNKLEGGPGRPVSEGGAGYSCIAELRMIETIEGGA
PKTQFLKFGDVVRIEMKDRTGHSIFGAIEQKVGKYERG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory