Comparing SMc03211 FitnessBrowser__Smeli:SMc03211 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1cjxA Crystal structure of pseudomonas fluorescens hppd (see paper)
51% identity, 94% coverage: 16:364/370 of query aligns to 2:351/352 of 1cjxA
7xntA Crystal structure of pfhppd-y13161 complex
50% identity, 93% coverage: 16:358/370 of query aligns to 5:341/341 of 7xntA
7x8eA Crystal structure of pfhppd-y13287 complex
49% identity, 94% coverage: 16:362/370 of query aligns to 4:341/341 of 7x8eA
7xntC Crystal structure of pfhppd-y13161 complex
47% identity, 91% coverage: 16:353/370 of query aligns to 4:320/320 of 7xntC
5hmqD Xylose isomerase-like tim barrel/4-hydroxyphenylpyruvate dioxygenase fusion protein
33% identity, 92% coverage: 8:346/370 of query aligns to 288:611/624 of 5hmqD
Sites not aligning to the query:
Q88JU3 3-dehydroshikimate dehydratase; DSD; EC 4.2.1.118 from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) (see paper)
32% identity, 92% coverage: 8:346/370 of query aligns to 286:614/635 of Q88JU3
Sites not aligning to the query:
7yvvA Acmp1, r-4-hydroxymandelate synthase
33% identity, 75% coverage: 80:355/370 of query aligns to 66:331/335 of 7yvvA
1t47A Structure of fe2-hppd bound to ntbc (see paper)
32% identity, 75% coverage: 81:358/370 of query aligns to 78:360/362 of 1t47A
5ec3A Structural insight into the catalyitc mechanism of human 4- hydroxyphenylpyruvate dioxygenase
27% identity, 87% coverage: 42:364/370 of query aligns to 30:373/376 of 5ec3A
8im2A Crystal structure of human hppd complexed with ntbc (see paper)
26% identity, 87% coverage: 42:362/370 of query aligns to 32:373/374 of 8im2A
8im3A Crystal structure of human hppd complexed with compound a10 (see paper)
26% identity, 86% coverage: 42:358/370 of query aligns to 32:369/371 of 8im3A
P32755 4-hydroxyphenylpyruvate dioxygenase; 4-hydroxyphenylpyruvic acid oxidase; 4HPPD; HPD; HPPDase; F Alloantigen; F protein; EC 1.13.11.27 from Rattus norvegicus (Rat) (see 2 papers)
27% identity, 87% coverage: 42:364/370 of query aligns to 38:381/393 of P32755
Sites not aligning to the query:
2r5vA Hydroxymandelate synthase crystal structure (see paper)
27% identity, 86% coverage: 41:358/370 of query aligns to 28:344/346 of 2r5vA
O52791 4-hydroxymandelate synthase; HMS; HmaS; 4-hydroxyphenylpyruvate dioxygenase II; EC 1.13.11.46 from Amycolatopsis orientalis (Nocardia orientalis) (see paper)
26% identity, 88% coverage: 41:365/370 of query aligns to 29:353/357 of O52791
Q02110 4-hydroxyphenylpyruvate dioxygenase; 4-hydroxyphenylpyruvic acid oxidase; 4HPPD; HPD; HPPDase; EC 1.13.11.27 from Sus scrofa (Pig) (see paper)
31% identity, 55% coverage: 161:364/370 of query aligns to 174:381/393 of Q02110
Sites not aligning to the query:
5yy6A Crystal structure of arabidopsis thaliana hppd truncated mutant complexed with benquitrione (see paper)
30% identity, 75% coverage: 80:355/370 of query aligns to 97:371/371 of 5yy6A
P93836 4-hydroxyphenylpyruvate dioxygenase; 4-hydroxyphenylpyruvic acid oxidase; 4HPPD; HPD; HPPDase; EC 1.13.11.27 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
30% identity, 75% coverage: 80:355/370 of query aligns to 131:432/445 of P93836
5ywhA Crystal structure of arabidopsis thaliana hppd complexed with y13508
30% identity, 75% coverage: 80:355/370 of query aligns to 96:370/372 of 5ywhA
3zgjB S221m v223f y359a mutant of 4-hydroxymandelate synthase from streptomyces coelicolor (see paper)
25% identity, 86% coverage: 40:358/370 of query aligns to 23:342/343 of 3zgjB
1sqdA Structural basis for inhibitor selectivity revealed by crystal structures of plant and mammalian 4-hydroxyphenylpyruvate dioxygenases (see paper)
30% identity, 74% coverage: 80:354/370 of query aligns to 97:373/373 of 1sqdA
>SMc03211 FitnessBrowser__Smeli:SMc03211
MGPFPHDAPPPAISAENPAGTDGFEFVEFAHPEPEKLAELFGRMGYTPIARHKTKDITVW
RQGDINYVLNAQAGSHAMRFVGEHGPCAPSMAWRVVDAKHAFEHAVAKGAEAYTGNNKCL
DVPAIVGIGGSLLYFVEAYGEKGSAYDAEFEWLGERDPKPPGVGFYYLDHLTHNVYRGNM
DKWWAFYRELFNFKQIHFFDIDGRITGLVSRAITSPCGKIRIPLNESKDDTSQIEEYLKK
YKGEGIQHIAVGTEAIYDATDKLAENGLKFMPGPPETYYEMSHQRVHGHDEPIDRMRTHG
ILIDGEGVVNGGMTKILLQIFSRTVIGPIFFEFIQRKGDEGFGEGNFRALFESIEADQIR
RGVLGHEAAE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory