SitesBLAST
Comparing SMc03252 FitnessBrowser__Smeli:SMc03252 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0A7B5 Glutamate 5-kinase; Gamma-glutamyl kinase; GK; EC 2.7.2.11 from Escherichia coli (strain K12) (see paper)
35% identity, 85% coverage: 20:258/282 of query aligns to 1:238/367 of P0A7B5
- S50 (= S70) binding
- D137 (= D157) binding
- N149 (= N169) binding
2j5tD Glutamate 5-kinase from escherichia coli complexed with glutamate (see paper)
35% identity, 83% coverage: 26:258/282 of query aligns to 5:236/365 of 2j5tD
Sites not aligning to the query:
7f5xA Gk domain of drosophila p5cs filament with glutamate (see paper)
31% identity, 90% coverage: 16:268/282 of query aligns to 5:227/236 of 7f5xA
7wx3B Gk domain of drosophila p5cs filament with glutamate, atp, and NADPH (see paper)
31% identity, 90% coverage: 16:268/282 of query aligns to 5:249/258 of 7wx3B
- binding gamma-glutamyl phosphate: S59 (= S70), A61 (= A72), N149 (= N154), T150 (≠ E155), D152 (= D157), M158 (≠ C162), N165 (= N169)
- binding : E72 (≠ Y86), M75 (≠ V89), L77 (vs. gap), S78 (vs. gap), M79 (vs. gap), R80 (vs. gap)
2akoA Crystal structure of glutamate 5-kinase from campylobacter jejuni
29% identity, 82% coverage: 26:256/282 of query aligns to 3:219/241 of 2akoA
- binding adenosine-5'-diphosphate: H10 (≠ T33), S161 (= S189), D162 (≠ N190), I163 (≠ V191), F166 (≠ L194), Y167 (≠ F195), N170 (≠ D198), P171 (= P199), T194 (≠ S231), G196 (= G233), K200 (= K237)
2j5vB Glutamate 5-kinase from escherichia coli complexed with glutamyl-5- phosphate and pyroglutamic acid (see paper)
30% identity, 83% coverage: 26:258/282 of query aligns to 5:196/325 of 2j5vB
- binding pyroglutamic acid: T11 (≠ S32), G49 (= G71), A50 (= A72), I51 (≠ V73), A52 (= A74), D135 (= D157)
- binding gamma-glutamyl phosphate: K8 (= K29), S48 (= S70), D135 (= D157), G145 (= G167), D146 (= D168), N147 (= N169)
2j5vA Glutamate 5-kinase from escherichia coli complexed with glutamyl-5- phosphate and pyroglutamic acid (see paper)
35% identity, 59% coverage: 26:190/282 of query aligns to 5:168/323 of 2j5vA
- binding magnesium ion: K8 (= K29), G10 (= G31), L166 (= L188)
- binding pyroglutamic acid: T11 (≠ S32), S48 (= S70), G49 (= G71), A50 (= A72), I51 (≠ V73)
- binding gamma-glutamyl phosphate: K8 (= K29), G10 (= G31), S48 (= S70), D135 (= D157), D146 (= D168), N147 (= N169)
7n9dA I74a mutant of the isopentenyl phosphate kinase from candidatus methanomethylophilus alvus (see paper)
24% identity, 87% coverage: 25:268/282 of query aligns to 2:245/253 of 7n9dA
- binding (2E)-3-phenylbut-2-en-1-yl dihydrogen phosphate: G45 (= G71), A46 (= A72), G50 (= G76), H51 (≠ S77), A75 (≠ Q100), T79 (vs. gap), G135 (≠ N154), D136 (≠ E155), V137 (≠ N156), I147 (≠ V166), S149 (≠ D168), G150 (≠ N169), T208 (≠ S231)
- binding adenosine-5'-diphosphate: G8 (= G31), G9 (≠ S32), S10 (≠ T33), K15 (≠ R38), S170 (= S189), D171 (≠ N190), I172 (≠ V191), Y176 (≠ F195), A178 (≠ K197), D179 (= D198), D201 (≠ T223), G210 (= G233), V211 (≠ M234), K214 (= K237)
7lntB Ternary complex of the isopentenyl phosphate kinase from candidatus methanomethylophilus alvus bound to benzyl monophosphate and atp (see paper)
22% identity, 87% coverage: 23:268/282 of query aligns to 1:248/260 of 7lntB
- binding adenosine-5'-diphosphate: G9 (= G31), G10 (≠ S32), S11 (≠ T33), D172 (≠ N190), I173 (≠ V191), Y177 (≠ F195), D180 (= D198)
- binding (phenylmethyl) dihydrogen phosphate: A47 (= A72), G51 (= G76), H52 (≠ S77), I148 (≠ V166), S150 (≠ D168)
3ll5A Crystal structure of t. Acidophilum isopentenyl phosphate kinase product complex (see paper)
25% identity, 70% coverage: 25:221/282 of query aligns to 2:197/233 of 3ll5A
- binding adenosine-5'-diphosphate: G8 (= G31), S10 (≠ T33), K15 (≠ R38), D165 (≠ N190), Y170 (≠ F195), D173 (= D198), P174 (= P199), K175 (≠ R200), I190 (= I214), K193 (≠ E217)
- binding 3-methylbut-3-enyl trihydrogen diphosphate: K6 (= K29), G9 (≠ S32), K15 (≠ R38), G45 (= G71), G46 (≠ A72), G47 (≠ V73), G50 (= G76), H51 (≠ S77), G129 (≠ N156), S143 (≠ V166), G144 (= G167)
7lnuB Ternary complex of the isopentenyl phosphate kinase from candidatus methanomethylophilus alvus bound to isopentenyl monophosphate and atp (see paper)
22% identity, 87% coverage: 23:268/282 of query aligns to 2:249/261 of 7lnuB
- binding adenosine-5'-diphosphate: K8 (= K29), S12 (≠ T33), S172 (= S189), D173 (≠ N190), I174 (≠ V191), Y178 (≠ F195), A180 (≠ K197), K183 (≠ R200), K218 (= K237)
- binding Isopentenyl phosphate: A48 (= A72), G52 (= G76), H53 (≠ S77), I149 (≠ V166), S151 (≠ D168), G152 (≠ N169)
3lkkB Crystal structure of the isopentenyl phosphate kinase substrate complex (see paper)
25% identity, 70% coverage: 25:222/282 of query aligns to 3:203/238 of 3lkkB
- binding adenosine-5'-triphosphate: K7 (= K29), G9 (= G31), G10 (≠ S32), S11 (≠ T33), K16 (≠ R38), G48 (≠ V73), H52 (≠ S77), D166 (≠ N190), V167 (= V191), Y171 (≠ F195), D174 (= D198), P175 (= P199), K176 (≠ R200), I195 (= I214), K198 (≠ E217)
- binding Isopentenyl phosphate: K7 (= K29), G46 (= G71), G47 (≠ A72), G51 (= G76), H52 (≠ S77), G130 (≠ N156), D131 (= D157), I142 (≠ T164), S144 (≠ V166), G145 (= G167)
2bmuB Ump kinase from pyrococcus furiosus complexed with its substrate ump and its substrate analog amppnp (see paper)
27% identity, 38% coverage: 163:268/282 of query aligns to 114:217/226 of 2bmuB
- binding phosphoaminophosphonic acid-adenylate ester: T141 (≠ S189), N142 (= N190), V146 (≠ L194), Y147 (≠ F195), A149 (≠ K197), D150 (= D198), P151 (= P199), S182 (≠ G232), S183 (≠ G233), V184 (≠ M234)
- binding magnesium ion: D122 (= D170), D122 (= D170), S183 (≠ G233), V184 (≠ M234)
- binding uridine-5'-monophosphate: G114 (= G163), T115 (= T164), H116 (≠ R165), H119 (≠ D168), T120 (≠ N169), T121 (vs. gap), A179 (≠ Y229)
Sites not aligning to the query:
Q8U122 Uridylate kinase; UK; Uridine monophosphate kinase; UMP kinase; UMPK; EC 2.7.4.22 from Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) (see paper)
27% identity, 38% coverage: 163:268/282 of query aligns to 113:216/225 of Q8U122
- 114:120 (vs. 164:169, 29% identical) binding
- T120 (vs. gap) binding
- D121 (= D170) binding ; binding
- G179 (≠ S230) binding
- S182 (≠ G233) binding
Sites not aligning to the query:
- 6 binding
- 44 binding
- 66 binding
7lntA Ternary complex of the isopentenyl phosphate kinase from candidatus methanomethylophilus alvus bound to benzyl monophosphate and atp (see paper)
23% identity, 71% coverage: 23:221/282 of query aligns to 1:200/238 of 7lntA
- binding adenosine-5'-diphosphate: G9 (= G31), S11 (≠ T33), K16 (≠ R38), S171 (= S189), D172 (≠ N190), I173 (≠ V191), Y177 (≠ F195), A179 (≠ K197), D180 (= D198), P181 (= P199), K182 (≠ R200), K196 (≠ E217)
- binding (phenylmethyl) dihydrogen phosphate: G46 (= G71), A47 (= A72), G51 (= G76), H52 (≠ S77), I148 (≠ V166), S150 (≠ D168), G151 (≠ N169)
7lnwA I146a mutant of the isopentenyl phosphate kinase from candidatus methanomethylophilus alvus (see paper)
23% identity, 87% coverage: 25:268/282 of query aligns to 2:244/256 of 7lnwA
- binding adenosine-5'-diphosphate: K6 (= K29), S10 (≠ T33), K15 (≠ R38), D171 (≠ N190), I172 (≠ V191), Y176 (≠ F195), D179 (= D198), P180 (= P199), K181 (≠ R200), V210 (≠ M234), K213 (= K237)
- binding [(~{Z})-5-[(azanylidene-$l^{4}-azanylidene)amino]-3-methyl-pent-2-enyl] dihydrogen phosphate: G45 (= G71), A46 (= A72), G50 (= G76), H51 (≠ S77), G135 (≠ N154), D136 (≠ E155), V148 (≠ G167), S149 (≠ D168)
2ji5A Structure of ump kinase from pyrococcus furiosus complexed with utp
27% identity, 38% coverage: 163:268/282 of query aligns to 115:210/219 of 2ji5A
Sites not aligning to the query:
7lnuA Ternary complex of the isopentenyl phosphate kinase from candidatus methanomethylophilus alvus bound to isopentenyl monophosphate and atp (see paper)
23% identity, 71% coverage: 23:221/282 of query aligns to 1:200/239 of 7lnuA
- binding adenosine-5'-diphosphate: G9 (= G31), G10 (≠ S32), S11 (≠ T33), K16 (≠ R38), D172 (≠ N190), I173 (≠ V191), L176 (= L194), D180 (= D198), K182 (≠ R200)
- binding adenosine-5'-triphosphate: K7 (= K29), G9 (= G31), G10 (≠ S32), S11 (≠ T33), K16 (≠ R38), D172 (≠ N190), L176 (= L194), A179 (≠ K197), D180 (= D198), K182 (≠ R200)
- binding Isopentenyl phosphate: G46 (= G71), A47 (= A72), G51 (= G76), H52 (≠ S77), G136 (≠ N154), I148 (≠ V166), S150 (≠ D168), G151 (≠ N169)
- binding 3-methylbut-3-enyl trihydrogen diphosphate: A47 (= A72), G51 (= G76), H52 (≠ S77), G136 (≠ N154), I148 (≠ V166), G151 (≠ N169)
7lnxB I146a mutant of the isopentenyl phosphate kinase from candidatus methanomethylophilus alvus (see paper)
22% identity, 87% coverage: 23:268/282 of query aligns to 4:235/247 of 7lnxB
- binding adenosine-5'-diphosphate: K10 (= K29), S14 (≠ T33), S174 (= S189), D175 (≠ N190), I176 (≠ V191), Y180 (≠ F195), A182 (≠ K197), D183 (= D198), P184 (= P199), K185 (≠ R200), K204 (= K237)
- binding (2E)-3-methylhept-2-en-1-yl dihydrogen phosphate: A50 (= A72), G54 (= G76), H55 (≠ S77), A58 (≠ V80), D140 (≠ E155), V141 (≠ N156), A151 (≠ V166), G154 (≠ N169)
7lnxA I146a mutant of the isopentenyl phosphate kinase from candidatus methanomethylophilus alvus (see paper)
23% identity, 68% coverage: 25:217/282 of query aligns to 1:194/234 of 7lnxA
- binding adenosine-5'-diphosphate: K5 (= K29), S9 (≠ T33), I171 (≠ V191), L174 (= L194), Y175 (≠ F195), A177 (≠ K197), D178 (= D198), P179 (= P199), K180 (≠ R200)
- binding (2Z)-3-methylhept-2-en-1-yl trihydrogen diphosphate: G8 (≠ S32), K14 (≠ R38), G44 (= G71), A45 (= A72), G46 (≠ V73), G49 (= G76), H50 (≠ S77), G134 (≠ N154), D135 (≠ E155), A146 (≠ V166), S148 (≠ D168), G149 (≠ N169)
Query Sequence
>SMc03252 FitnessBrowser__Smeli:SMc03252
MAPFSSLGESRSKMEDKFDLSSARLVVVKIGSTLVLDRETSGIRSSWLESLTEDVSRLLT
RGQQVVLVSSGAVAIGSTIVDRLATYSQVSHKQAAAALGQVQLTHAYSESLKRHGLQVAQ
LLMGRGDLVDPAHRLNTRAVLLRLIDLGAVPLVNENDTTATCGTRVGDNDRLAAWIAEII
NADLLILLSNVDGLFMKDPRNNPLTPMLTEVESITREIEAMATQSVDPYSSGGMISKIEA
GKIAMNAGCRMIIANGTRSHPLYAIESGGPSTHFIPVARDRV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory