Comparing SMc03813 SMc03813 periplasmic binding ABC transporter protein to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2h3hA Crystal structure of the liganded form of thermotoga maritima glucose binding protein (see paper)
31% identity, 83% coverage: 47:327/337 of query aligns to 18:288/313 of 2h3hA
Sites not aligning to the query:
3c6qC Apo and ligand-bound form of a thermophilic glucose/xylose binding protein
31% identity, 83% coverage: 47:327/337 of query aligns to 18:288/305 of 3c6qC
Sites not aligning to the query:
6guqA Crystal structure of ganp, a glucose-galactose binding protein from geobacillus stearothermophilus, in complex with glucose
25% identity, 88% coverage: 31:327/337 of query aligns to 3:275/278 of 6guqA
6gt9A Crystal structure of ganp, a glucose-galactose binding protein from geobacillus stearothermophilus, in complex with galactose
25% identity, 88% coverage: 31:327/337 of query aligns to 8:280/283 of 6gt9A
5hqjA Crystal structure of abc transporter solute binding protein b1g1h7 from burkholderia graminis c4d1m, target efi-511179, in complex with d-arabinose
28% identity, 92% coverage: 26:334/337 of query aligns to 3:289/289 of 5hqjA
4wutA Crystal structure of an abc transporter solute binding protein (ipr025997) from agrobacterium vitis (avi_5133, target efi-511220) with bound d-fucose
26% identity, 88% coverage: 31:327/337 of query aligns to 2:279/290 of 4wutA
7x0hA Crystal structure of sugar binding protein cbpa complexed wtih glucose from clostridium thermocellum (see paper)
29% identity, 76% coverage: 49:303/337 of query aligns to 27:254/287 of 7x0hA
Sites not aligning to the query:
2ioyA Crystal structure of thermoanaerobacter tengcongensis ribose binding protein (see paper)
25% identity, 88% coverage: 30:327/337 of query aligns to 1:272/274 of 2ioyA
5xssA Xylfii molecule (see paper)
26% identity, 82% coverage: 31:306/337 of query aligns to 5:257/274 of 5xssA
1tjyA Crystal structure of salmonella typhimurium ai-2 receptor lsrb in complex with r-thmf (see paper)
27% identity, 62% coverage: 27:236/337 of query aligns to 2:195/316 of 1tjyA
Sites not aligning to the query:
5dteB Crystal structure of an abc transporter periplasmic solute binding protein (ipr025997) from actinobacillus succinogenes 130z(asuc_0081, target efi-511065) with bound d-allose
27% identity, 44% coverage: 31:177/337 of query aligns to 4:153/287 of 5dteB
Sites not aligning to the query:
3t95A Crystal structure of lsrb from yersinia pestis complexed with autoinducer-2 (see paper)
27% identity, 61% coverage: 30:236/337 of query aligns to 2:193/314 of 3t95A
Sites not aligning to the query:
8wlbA X-ray structure of enterobacter cloacae allose-binding protein in complex with d-psicose (see paper)
26% identity, 85% coverage: 31:318/337 of query aligns to 3:275/288 of 8wlbA
8wl9A X-ray structure of enterobacter cloacae allose-binding protein in complex with d-ribose (see paper)
26% identity, 85% coverage: 31:318/337 of query aligns to 3:275/288 of 8wl9A
1rpjA Crystal structure of d-allose binding protein from escherichia coli (see paper)
26% identity, 85% coverage: 31:317/337 of query aligns to 3:274/288 of 1rpjA
1gudA Hinge-bending motion of d-allose binding protein from escherichia coli: three open conformations (see paper)
26% identity, 85% coverage: 31:317/337 of query aligns to 3:274/288 of 1gudA
1dbpA Identical mutations at corresponding positions in two homologous proteins with non-identical effects (see paper)
25% identity, 84% coverage: 32:313/337 of query aligns to 4:258/271 of 1dbpA
4rxtA Crystal structure of carbohydrate transporter solute binding protein arad_9553 from agrobacterium radiobacter, target efi-511541, in complex with d-arabinose
26% identity, 82% coverage: 50:324/337 of query aligns to 25:281/295 of 4rxtA
Sites not aligning to the query:
5dkvA Crystal structure of an abc transporter solute binding protein from agrobacterium vitis(avis_5339, target efi-511225) bound with alpha-d- tagatopyranose
23% identity, 77% coverage: 65:323/337 of query aligns to 41:286/303 of 5dkvA
Sites not aligning to the query:
4pz0A The crystal structure of a solute binding protein from bacillus anthracis str. Ames in complex with quorum-sensing signal autoinducer-2 (ai-2)
31% identity, 32% coverage: 27:134/337 of query aligns to 5:108/321 of 4pz0A
Sites not aligning to the query:
>SMc03813 SMc03813 periplasmic binding ABC transporter protein
MQPVRTLTAALSVACLAAGLTAPQANAADREFALVFKVLNNAFSPPIQQGCEAAAKKLGD
VTCTYLGPTEYDEAKQVQLAQDMVTRGVAGLGVSAGNPKAMARIMKMAQDKGIPVVTFDT
DVLPEDAGLRSTYIGTDNYEFGIALAQKVLESKKDGGTVCIQSGAPASENLKARVQGIRD
TLAGVTKDKGAEKLTGQNGWTEPAGCPVYNNDDITLAAQQVRDVMTNNPELSAFVAVGGW
AQYAPQAYKQAMEPLKARLDSKDLVVVFGDNFGPQLPLLAEGLSHYNIGQRPYDMGYETI
MALDKLTKGEKVEPFIKTGTEVCTPEDALTTCGKTAN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory