Comparing SMc03815 FitnessBrowser__Smeli:SMc03815 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
34% identity, 93% coverage: 13:254/259 of query aligns to 1:239/501 of P04983
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
31% identity, 86% coverage: 16:237/259 of query aligns to 4:231/254 of 1g6hA
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
31% identity, 86% coverage: 16:237/259 of query aligns to 4:231/253 of 1g9xB
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
30% identity, 88% coverage: 21:248/259 of query aligns to 6:223/240 of 4ymuJ
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
32% identity, 90% coverage: 16:248/259 of query aligns to 2:223/241 of 4u00A
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
31% identity, 84% coverage: 16:232/259 of query aligns to 3:218/226 of 5xu1B
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
31% identity, 89% coverage: 19:248/259 of query aligns to 6:228/353 of 1oxvD
1oxvA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
31% identity, 89% coverage: 19:248/259 of query aligns to 6:228/353 of 1oxvA
1oxuA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
31% identity, 89% coverage: 19:248/259 of query aligns to 6:228/353 of 1oxuA
Q97UY8 Glucose import ATP-binding protein GlcV; EC 7.5.2.- from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
31% identity, 89% coverage: 19:248/259 of query aligns to 6:228/353 of Q97UY8
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
30% identity, 86% coverage: 13:235/259 of query aligns to 1:222/648 of P75831
5ws4A Crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii (see paper)
31% identity, 90% coverage: 16:248/259 of query aligns to 4:236/650 of 5ws4A
4yerA Crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution
28% identity, 84% coverage: 19:236/259 of query aligns to 7:216/285 of 4yerA
3d31A Modbc from methanosarcina acetivorans (see paper)
31% identity, 84% coverage: 31:248/259 of query aligns to 15:215/348 of 3d31A
Sites not aligning to the query:
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
29% identity, 94% coverage: 16:259/259 of query aligns to 1:244/343 of P30750
Sites not aligning to the query:
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
32% identity, 83% coverage: 18:232/259 of query aligns to 8:219/375 of 2d62A
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
29% identity, 94% coverage: 16:259/259 of query aligns to 2:245/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
29% identity, 94% coverage: 16:259/259 of query aligns to 2:245/344 of 3tuiC
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
29% identity, 94% coverage: 16:259/259 of query aligns to 2:245/344 of 6cvlD
5x40A Structure of a cbio dimer bound with amppcp (see paper)
31% identity, 87% coverage: 13:237/259 of query aligns to 1:221/280 of 5x40A
>SMc03815 FitnessBrowser__Smeli:SMc03815
MFGNTTKVPVGAMTVLARLENIVKDFGAVRALDGVTLEINQGEILGLMGDNGAGKSTLVK
TIAGNFQPSSGSYILEGKPVVFSGPAEARRHGIEVVYQDLAICDNLTASANVFLGRELMR
QVGPFKVLDHKRMNARSAEIFKELKSETRPADLVVRMSGGQRQAVAIARTRLARSKIVLM
DEPTAAISVRQVAEVLALIRRMKAQGLSVILISHRMPDVFEVCDRVVVMRRGRKVADKMI
GQSSPEEVTGLITGAIQTA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory