Comparing SMc03846 SMc03846 aconitate hydratase to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
A0QX20 Aconitate hydratase A; ACN; Aconitase; (2R,3S)-2-methylisocitrate dehydratase; (2S,3R)-3-hydroxybutane-1,2,3-tricarboxylate dehydratase; Iron-responsive protein-like; IRP-like; Probable 2-methyl-cis-aconitate hydratase; RNA-binding protein; EC 4.2.1.3; EC 4.2.1.99 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
56% identity, 99% coverage: 4:894/896 of query aligns to 10:938/943 of A0QX20
P09339 Aconitate hydratase A; ACN; Aconitase; Aconitate/2-methylaconitate hydratase; Iron-responsive protein-like; IRP-like; RNA-binding protein; EC 4.2.1.3; EC 4.2.1.- from Bacillus subtilis (strain 168) (see 2 papers)
55% identity, 99% coverage: 6:893/896 of query aligns to 11:904/909 of P09339
Sites not aligning to the query:
Q9SIB9 Aconitate hydratase 3, mitochondrial; Aconitase 3; mACO1; Citrate hydro-lyase 3; EC 4.2.1.3 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
54% identity, 97% coverage: 23:895/896 of query aligns to 117:988/990 of Q9SIB9
Sites not aligning to the query:
P21399 Cytoplasmic aconitate hydratase; Aconitase; Citrate hydro-lyase; Ferritin repressor protein; Iron regulatory protein 1; IRP1; Iron-responsive element-binding protein 1; IRE-BP 1; EC 4.2.1.3 from Homo sapiens (Human) (see 2 papers)
51% identity, 96% coverage: 39:895/896 of query aligns to 34:888/889 of P21399
2b3xA Structure of an orthorhombic crystal form of human cytosolic aconitase (irp1) (see paper)
51% identity, 96% coverage: 39:895/896 of query aligns to 33:887/888 of 2b3xA
3snpA Crystal structure analysis of iron regulatory protein 1 in complex with ferritin h ire RNA (see paper)
50% identity, 96% coverage: 39:895/896 of query aligns to 33:849/850 of 3snpA
P19414 Aconitate hydratase, mitochondrial; Aconitase; Citrate hydro-lyase; EC 4.2.1.3 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 2 papers)
27% identity, 86% coverage: 82:848/896 of query aligns to 85:731/778 of P19414
Sites not aligning to the query:
P39533 Homocitrate dehydratase, mitochondrial; Aconitase 2; EC 4.2.1.- from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
26% identity, 89% coverage: 40:840/896 of query aligns to 54:729/789 of P39533
8acnA Crystal structures of aconitase with isocitrate and nitroisocitrate bound (see paper)
27% identity, 88% coverage: 85:868/896 of query aligns to 64:726/753 of 8acnA
1fghA Complex with 4-hydroxy-trans-aconitate (see paper)
27% identity, 88% coverage: 85:868/896 of query aligns to 64:726/753 of 1fghA
1amjA Steric and conformational features of the aconitase mechanism (see paper)
27% identity, 88% coverage: 85:868/896 of query aligns to 64:726/753 of 1amjA
1amiA Steric and conformational features of the aconitase mechanism (see paper)
27% identity, 88% coverage: 85:868/896 of query aligns to 64:726/753 of 1amiA
1acoA Crystal structure of aconitase with transaconitate bound (see paper)
27% identity, 88% coverage: 85:868/896 of query aligns to 64:726/753 of 1acoA
1nisA Crystal structure of aconitase with trans-aconitate and nitrocitrate bound (see paper)
27% identity, 88% coverage: 85:868/896 of query aligns to 64:726/753 of 1nisA
P20004 Aconitate hydratase, mitochondrial; Aconitase; Citrate hydro-lyase; EC 4.2.1.3 from Bos taurus (Bovine) (see 2 papers)
27% identity, 91% coverage: 50:868/896 of query aligns to 53:754/780 of P20004
5acnA Structure of activated aconitase. Formation of the (4fe-4s) cluster in the crystal (see paper)
27% identity, 88% coverage: 85:868/896 of query aligns to 65:727/754 of 5acnA
1b0kA S642a:fluorocitrate complex of aconitase (see paper)
27% identity, 88% coverage: 85:868/896 of query aligns to 64:726/753 of 1b0kA
P16276 Aconitate hydratase, mitochondrial; Aconitase; Citrate hydro-lyase; EC 4.2.1.3 from Sus scrofa (Pig) (see 3 papers)
27% identity, 88% coverage: 85:868/896 of query aligns to 92:754/781 of P16276
Sites not aligning to the query:
O14289 3-isopropylmalate dehydratase; Alpha-IPM isomerase; IPMI; Isopropylmalate isomerase; EC 4.2.1.33 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
26% identity, 42% coverage: 210:583/896 of query aligns to 135:487/758 of O14289
Sites not aligning to the query:
4nqyA The reduced form of mj0499 (see paper)
25% identity, 45% coverage: 161:566/896 of query aligns to 70:404/409 of 4nqyA
Sites not aligning to the query:
>SMc03846 SMc03846 aconitate hydratase
MSKSLDSFNCRSTLTVNGVDYVYYSLPKAEANGLAGISKLPYSMKVLLENLLRNEDGRSV
TKKDIENIAAWLGDKGTAENEIAYRPARVLMQDFTGVPAVVDLAAMRDAMVSLGGDPEKI
NPLVPVDLVIDHSVIVDEFGTPTAFARNVELEYQRNGERYRFLKWGQQAFKNFRVVPPGT
GICHQVNLEYLGQAVWTREEDGEVTAYPDTCVGTDSHTTMINGLGVLGWGVGGIEAEAAM
LGQPVSMLLPEVIGFKLTGKLKEGVTATDLVLTVVQMLRKKGVVSKFVEFFGPGLDNMTL
ADRATIGNMGPEYGATCGFFPVDAETINYLTISGREEQRIALVEAYSKAQGMWREGDGSE
LVFTDTLELDLGDVVPSMAGPKRPEGRIALENIASGFAAALDNDYKKPGQLANRYAVEGT
DYDLGHGDVAIAAITSCTNTSNPSVLIAAGLLARNAVAKGLKTQPWVKTSLAPGSQVVAE
YLSKSGLQTDLDKLGFNLVGFGCTTCIGNSGPLPTEISKTINDKGLIAAGVLSGNRNFEG
RISPDVQANYLASPPLVVAYALAGSVQKDLTKEPIGEDRDGQPVYLRDIWPTSQEIQDFI
FRYVTRELYATKYADVFKGDANWQAVQVPAGQTYAWDEGSTYVQNPPYFVGMGKKGAGIS
DIKNARVLGLFGDKITTDHISPAGSIKAASPAGAYLLEHGVGIADFNQYGTRRGNHEVMM
RGTFANIRIRNHMLGPNGKEGGYTIHYPSKEEMSIYDAAMQYKEEGVPLVIFAGVEYGNG
SSRDWAAKGTNLLGVKAVIAQSFERIHRSNLVGMGVVPFVFEEGMTWESLGLKGDEVVTI
ENLANVQPREKRVAKITYGDGSVKEVPLICRIDTLDEVTYVNNGGILQTVLRDLAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory