Comparing SMc03858 FitnessBrowser__Smeli:SMc03858 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 1 hits to proteins with known functional sites (download)
2gtvX Nmr structure of monomeric chorismate mutase from methanococcus jannaschii (see paper)
33% identity, 78% coverage: 8:94/111 of query aligns to 3:93/104 of 2gtvX
Sites not aligning to the query:
>SMc03858 FitnessBrowser__Smeli:SMc03858
MLDPEIKEELASYRQSIDNIDAALVHMLAERFRCTKAVGVLKAKHQLPPADPAREEYQIE
RLRHLAKDANLDPDFAEKFLNFIIKEVIRHHEAIAADCSQNAGSAGTTHSA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory