Comparing SMc03882 FitnessBrowser__Smeli:SMc03882 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4isdA Crystal structure of glutathione transferase homolog from burkholderia gl bgr1, target efi-501803, with bound glutathione
28% identity, 93% coverage: 4:204/215 of query aligns to 5:185/187 of 4isdA
O43708 Maleylacetoacetate isomerase; MAAI; GSTZ1-1; Glutathione S-transferase zeta 1; EC 5.2.1.2; EC 2.5.1.18 from Homo sapiens (Human) (see 10 papers)
32% identity, 52% coverage: 2:112/215 of query aligns to 4:115/216 of O43708
Sites not aligning to the query:
Q9WVL0 Maleylacetoacetate isomerase; MAAI; GSTZ1-1; Glutathione S-transferase zeta 1; EC 5.2.1.2; EC 2.5.1.18 from Mus musculus (Mouse)
34% identity, 52% coverage: 2:112/215 of query aligns to 4:115/216 of Q9WVL0
3qawA Crystal structure of a glutathione-s-transferase from antarctic clam laternula elliptica in a complex with glutathione (see paper)
24% identity, 86% coverage: 2:185/215 of query aligns to 1:199/219 of 3qawA
2cz2A Crystal structure of glutathione transferase zeta 1-1 (maleylacetoacetate isomerase) from mus musculus (form-1 crystal)
34% identity, 52% coverage: 2:112/215 of query aligns to 1:112/212 of 2cz2A
Sites not aligning to the query:
1fw1A Glutathione transferase zeta/maleylacetoacetate isomerase (see paper)
33% identity, 51% coverage: 3:112/215 of query aligns to 1:111/208 of 1fw1A
Sites not aligning to the query:
3qagA Human glutathione transferase o2 with glutathione -new crystal form (see paper)
25% identity, 89% coverage: 13:204/215 of query aligns to 30:207/238 of 3qagA
4xt0A Crystal structure of beta-etherase ligf from sphingobium sp. Strain syk-6 (see paper)
38% identity, 39% coverage: 17:100/215 of query aligns to 14:100/243 of 4xt0A
Sites not aligning to the query:
P77544 Glutathione S-transferase YfcF; EC 2.5.1.18 from Escherichia coli (strain K12) (see paper)
27% identity, 85% coverage: 4:186/215 of query aligns to 6:197/214 of P77544
4qq7A Crystal structure of putative stringent starvation protein a from burkholderia cenocepacia with bound glutathione
27% identity, 90% coverage: 4:196/215 of query aligns to 3:191/204 of 4qq7A
7aiaAAA Ganglioside-induced differentiation-associated protein 1 (see paper)
32% identity, 54% coverage: 2:117/215 of query aligns to 2:112/259 of 7aiaAAA
Sites not aligning to the query:
Q8TB36 Ganglioside-induced differentiation-associated protein 1; GDAP1 from Homo sapiens (Human) (see 12 papers)
32% identity, 53% coverage: 3:117/215 of query aligns to 25:134/358 of Q8TB36
Sites not aligning to the query:
4kdxA Crystal structure of a glutathione transferase family member from burkholderia graminis, target efi-507264, bound gsh, ordered domains, space group p21, form(1)
28% identity, 72% coverage: 45:199/215 of query aligns to 42:201/207 of 4kdxA
Sites not aligning to the query:
3uarA Crystal structure of glutathione transferase (target efi-501774) from methylococcus capsulatus str. Bath with gsh bound
27% identity, 84% coverage: 17:197/215 of query aligns to 12:194/203 of 3uarA
Sites not aligning to the query:
7dweA Crystal structure of a glutathione s-transferase sbgstu7 from salix babylonica in complex with glutathione
28% identity, 56% coverage: 14:134/215 of query aligns to 11:133/212 of 7dweA
8a0pA Crystal structure of poplar glutathione transferase u20 in complex with morin (see paper)
32% identity, 52% coverage: 14:125/215 of query aligns to 11:124/216 of 8a0pA
Sites not aligning to the query:
8a0rA Crystal structure of poplar glutathione transferase u20 in complex with pinocembrin (see paper)
32% identity, 53% coverage: 14:126/215 of query aligns to 10:124/215 of 8a0rA
Sites not aligning to the query:
8a0qA Crystal structure of poplar glutathione transferase u20 in complex with baicalein (see paper)
32% identity, 53% coverage: 14:126/215 of query aligns to 10:124/215 of 8a0qA
Sites not aligning to the query:
8a0oA Crystal structure of poplar glutathione transferase u20 in complex with galangin (see paper)
32% identity, 53% coverage: 14:126/215 of query aligns to 10:124/215 of 8a0oA
Sites not aligning to the query:
8a0iA Crystal structure of poplar glutathione transferase u20 in complex with glutathionylphenylacetophenone (see paper)
32% identity, 53% coverage: 14:126/215 of query aligns to 10:124/215 of 8a0iA
Sites not aligning to the query:
>SMc03882 FitnessBrowser__Smeli:SMc03882
MAKLVLYVGNKNYSSWSLRPWLALTAGGIPFEDVVVPFDFAAGNPRFHEISPTGRVPVLH
HGEIRIWESLAIIEYVAELFPDAGLWPEDRADRARARSYSMEMLSGFRALRGACPMNIRR
PRKAIALPDGVVEDVARIETIWRESVAQSGGPFLFGRFTAADAMFAPVVNRFETYELVAD
PATLAYIDAVKAHPAFRQWEEAARVETWIVPEDEA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory