Comparing SMc03943 FitnessBrowser__Smeli:SMc03943 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 7 hits to proteins with known functional sites (download)
7d50B Spua mutant - h221n with glutamyl-thioester (see paper)
43% identity, 100% coverage: 1:250/251 of query aligns to 6:252/255 of 7d50B
7d53A Spua mutant - h221n with glu (see paper)
43% identity, 98% coverage: 4:250/251 of query aligns to 4:246/249 of 7d53A
6vtvB Crystal structure of puud gamma-glutamyl-gamma-aminobutyrate hydrolase from e. Coli
40% identity, 99% coverage: 1:249/251 of query aligns to 3:249/252 of 6vtvB
P76038 Gamma-glutamyl-gamma-aminobutyrate hydrolase PuuD; Gamma-Glu-GABA hydrolase; EC 3.5.1.94 from Escherichia coli (strain K12) (see paper)
40% identity, 99% coverage: 1:249/251 of query aligns to 5:251/254 of P76038
7d4rB Spua native structure (see paper)
38% identity, 98% coverage: 4:250/251 of query aligns to 2:214/215 of 7d4rB
3fijA Crystal structure of a uncharacterized protein lin1909
40% identity, 74% coverage: 58:243/251 of query aligns to 42:221/224 of 3fijA
O33341 Putative glutamine amidotransferase Rv2859c; EC 2.4.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
34% identity, 99% coverage: 2:250/251 of query aligns to 64:303/308 of O33341
>SMc03943 FitnessBrowser__Smeli:SMc03943
MSKPVVAIPCDFREFDGNVWHVAAHQYVRAAVEGAGLMVFLVPALEAGNDVDEILDRVDG
VLASGARSNVHPSLYGREASEADGPFDPGRDATSLPLIRRALDRGVPLFAICRGIQELNV
ALGGTLASEIQEQPGIWDHRKPEVPDLDVAYGIRQDVVVKEGSCLAPVLGTGRVRVNSLH
RQAIGAAAPRLAVEAVADDGTIEAVSVIGAKAFAVGVQWHPEYWVRTDAPSAALFKAFGD
AARAYCESKAS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory