Comparing SMc04023 FitnessBrowser__Smeli:SMc04023 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2ux8G Crystal structure of sphingomonas elodea atcc 31461 glucose-1- phosphate uridylyltransferase in complex with glucose-1-phosphate. (see paper)
58% identity, 95% coverage: 5:283/295 of query aligns to 3:279/288 of 2ux8G
2ux8A Crystal structure of sphingomonas elodea atcc 31461 glucose-1- phosphate uridylyltransferase in complex with glucose-1-phosphate. (see paper)
51% identity, 95% coverage: 5:283/295 of query aligns to 3:246/255 of 2ux8A
5i1fA Crystal structure of utp-glucose-1-phosphate uridylyltransferase from burkholderia vietnamiensis in complex with uridine-5'-diphosphate- glucose
48% identity, 93% coverage: 6:279/295 of query aligns to 4:277/290 of 5i1fA
5ve7A Crystal structure of utp-glucose-1-phosphate uridylyltransferase from burkholderia ambifaria in complex with utp
47% identity, 96% coverage: 6:289/295 of query aligns to 2:281/282 of 5ve7A
6knlA Uridine and triphosphate-bound ugpase from acinetobacter baumannii
46% identity, 92% coverage: 7:276/295 of query aligns to 2:275/290 of 6knlA
6k8dA Udp-glucose pyrophosphorylase with upg from acinetobacter baumanii
46% identity, 92% coverage: 7:276/295 of query aligns to 2:275/290 of 6k8dA
8f73E Crystal structure of pseudomonas aeruginosa udp-glucose phosphorylase in complex with udp-glucose
47% identity, 89% coverage: 7:269/295 of query aligns to 8:271/281 of 8f73E
6ikzB Udp-glucose pyrophosphorylase from acinetobacter baumanii
45% identity, 92% coverage: 7:276/295 of query aligns to 2:270/285 of 6ikzB
3jukA The crystal structure of udp-glucose pyrophosphorylase complexed with udp-glucose (see paper)
44% identity, 92% coverage: 7:276/295 of query aligns to 2:264/265 of 3jukA
3jukD The crystal structure of udp-glucose pyrophosphorylase complexed with udp-glucose (see paper)
44% identity, 92% coverage: 7:276/295 of query aligns to 2:264/264 of 3jukD
8b6dA Crystal structure of udp-glucose pyrophosphorylase from thermocrispum agreste dsm 44070 in complex with udp
42% identity, 92% coverage: 10:281/295 of query aligns to 5:278/291 of 8b6dA
8b68A Crystal structure of udp-glucose pyrophosphorylase from thermocrispum agreste dsm 44070 in complex with udp-glucose
40% identity, 92% coverage: 10:281/295 of query aligns to 5:273/286 of 8b68A
2pa4B Crystal structure of udp-glucose pyrophosphorylase from corynebacteria glutamicum in complex with magnesium and udp-glucose (see paper)
39% identity, 92% coverage: 7:276/295 of query aligns to 3:275/299 of 2pa4B
5ifyA Crystal structure of glucose-1-phosphate thymidylyltransferase from burkholderia vietnamiensis in complex with 2 -deoxyuridine-5'- monophosphate and 2'-deoxy-thymidine-b-l-rhamnose
28% identity, 90% coverage: 8:273/295 of query aligns to 2:239/293 of 5ifyA
Sites not aligning to the query:
6n0uA Crystal structure of a glucose-1-phosphate thymidylyltransferase from burkholderia phymatum bound to 2'-deoxy-thymidine-b-l-rhamnose
27% identity, 78% coverage: 8:236/295 of query aligns to 4:202/295 of 6n0uA
7d73E Cryo-em structure of gmppa/gmppb complex bound to gtp (state i) (see paper)
27% identity, 89% coverage: 9:272/295 of query aligns to 2:232/360 of 7d73E
7d72K Cryo-em structures of human gmppa/gmppb complex bound to gdp-mannose (see paper)
27% identity, 89% coverage: 9:272/295 of query aligns to 2:232/360 of 7d72K
7d72E Cryo-em structures of human gmppa/gmppb complex bound to gdp-mannose (see paper)
27% identity, 89% coverage: 9:272/295 of query aligns to 2:232/360 of 7d72E
O22287 Mannose-1-phosphate guanylyltransferase 1; GDP-mannose pyrophosphorylase 1; Protein CYTOKINESIS DEFECTIVE 1; Protein EMBRYO DEFECTIVE 101; Protein HYPERSENSITIVE TO AMMONIUM ION 1; Protein SENSITIVE TO OZONE 1; Protein VITAMIN C DEFECTIVE 1; EC 2.7.7.13 from Arabidopsis thaliana (Mouse-ear cress) (see 5 papers)
25% identity, 87% coverage: 9:266/295 of query aligns to 2:227/361 of O22287
Sites not aligning to the query:
7x8kB Arabidopsis gdp-d-mannose pyrophosphorylase (vtc1) structure (product- bound) (see paper)
25% identity, 87% coverage: 9:266/295 of query aligns to 2:227/367 of 7x8kB
>SMc04023 FitnessBrowser__Smeli:SMc04023
MTDKRKVRKAVFPVAGLGTRFLPATKAVPKEMLTVVDKPVIQYVVDEALEAGIEHLIFVT
GRSKAVIEDYFDIQVELDQTLRERNKKAEIELLEAMLPKAGTTSFTRQQAPLGLGHAVWC
ARDLVGNEPFALLLPDMIMKGEKGCLKGMVELYEESGGNVVAVEECAPDQAHKYGIVGVG
ETVGDGFRITRMVEKPAKGTAPSNFFINGRYILQPEIFPILETQERGAGNEIQLTDGMVK
LAEAQPFAAYHFRGDTYDCGAKDGFILANVAFALERGDIRPIVEGPLKTLLQGLK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory